ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7532

Name

YWHAG

Synonym

14-3-3GAMMA|PPP1R170;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma;YWHAG;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma

Definition

14-3-3 gamma|14-3-3 protein gamma|KCIP-1|protein kinase C inhibitor protein 1|protein phosphatase 1, regulatory subunit 170|tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide

Position

7q11.23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

Parkinson disease;PANTHER;P00049

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

Loss of proteins required for interphase microtubule organization from the centrosome;PID Reactome;500383

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Loss of Nlp from mitotic centrosomes;PID Reactome;500384

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

External Links

Links to cell senescence gene database

7532

Links to epithelial mesenchymal transition gene database

7532

Links to ovarian cancer gene database

7532

Links to endometrial cancer gene database

7532

Links to iHOP

7532

Sequence Information

Nucleotide Sequence

>7532 : length: 3779
AGGGGGTTGTCCGTCAGTGGCACGCACAGCAGCCGCAGCCGCCTCGCGCCCGGTCCCGCG
GTCGCAGCTCCAGCCGCCTCCTCCGCGCAGCCGCCGCCTCAGCTGCTCGCTCTGTGGGTC
GGTCCTCTCCGGCACTTGGGCTCCAGTCGCGCCCTCCAAGCCCTTCAGGCCGCCCCAGTG
TCCTCCTCCTTCTCCGGCCAGACCCAGCCCCGCGAAGATGGTGGACCGCGAGCAACTGGT
GCAGAAAGCCCGGCTGGCCGAGCAGGCGGAGCGCTACGACGACATGGCCGCGGCCATGAA
GAACGTGACAGAGCTGAATGAGCCACTGTCGAATGAGGAACGAAACCTTCTGTCTGTGGC
CTACAAGAACGTTGTGGGGGCACGCCGCTCTTCCTGGAGGGTCATCAGTAGCATTGAGCA
GAAGACATCTGCAGACGGCAATGAGAAGAAGATTGAGATGGTCCGTGCGTACCGGGAGAA
GATAGAGAAGGAGTTGGAGGCTGTGTGCCAGGATGTGCTGAGCCTGCTGGATAACTACCT
GATCAAGAATTGCAGCGAGACCCAGTACGAGAGCAAAGTGTTCTACCTGAAGATGAAAGG
GGACTACTACCGCTACCTGGCTGAAGTGGCCACCGGAGAGAAAAGGGCGACGGTGGTGGA
GTCCTCCGAGAAGGCCTACAGCGAAGCCCACGAGATCAGCAAAGAGCACATGCAGCCCAC
CCACCCCATCCGATTAGGCCTGGCTCTTAACTACTCCGTCTTCTACTATGAGATCCAGAA
CGCCCCAGAGCAAGCGTGCCACTTGGCCAAGACCGCGTTCGACGACGCCATCGCCGAGCT
TGACACCCTCAACGAGGACTCCTACAAGGACTCCACGCTCATCATGCAGCTCCTCCGCGA
CAACCTCACGCTCTGGACGAGCGACCAGCAGGACGACGATGGCGGCGAAGGCAACAATTA
AGGCCCCAGGGGAACTGGCAGCGCACGCGGATGCTACTACTGCAGTCTTTATTTTTTTCC
CATGAGTTGGGGGTCGGGTGGGGGAGGGAAAGGGAGGGATGACCTTCCCAGGGAGAAACC
CACGACCTGTCCTGTCTTTGATCGCCTCTTTGACATTTTTGCCAAAATACCACTAGTGGA
AAGTCAGGCTAGCTGTGCTGGTATTGGAATAGCAGCCTCACACTGGCGTCTGGACTGTTC
TGTAGATTCATGCAAGTGGAGCTGTCTGTCTCTAATTTAACTTATTGCTAGATAATAGGG
TTTTCAGATGAAAAGAAAACTTAAAGAGGAATGGCCCTCATTCAGTAAGTTCTGTGGTTC
CAGTAAGGATTTTTATGTACATACGCTCTCGTCTCTCGTTTTGGGTACTTTCTATCTCAT
CTGTCTCGGCTCTGCATGTTTTCCAGGGTGTAGCCTACAGACATGGAACAGTGTAAATCC
CAGACTGACAGACTTAGAACCTGAGGTCTCATTCATCCTTATGGTTTAGGCCTTGCCAGT
TTTCCGAAGTCTCTGATTAGTTGACAGTATTAACACTAAATTGCAGTTTACAGTATTTCT
ACATTACAGCCATATGTAACATCAAGCCATCGATTGTGTACTTTTCCTTTGCTAGTTGTT
TGGGCTTTAACATCCTTATTCAGCCTTATCCAGGTTGGTTTTGCTGTTGATCGGTCTCCT
AGGCTAAATGAGAATGAAAGCGACTTCAGGTCAGGTGGCTGTGGGATTTTTTTTTTTTGG
TCCTTCTTTCCTCTTAACGTAAATCCACCACCAAAATTATTAATCCTCTTGAGAGAAACG
TGAAACGCCACAAAAATAGAGAAAATTCAGGTCTGTATGTCATGGATCGTGTTGGTATTT
TCAGAGAACATCCCGCTTCTGAAGCTGCTGCAGCTCCCTCCTCAGGGATCACACTGCCGT
CACCCACTCTGCACTGGGGCGTTTCCTACTGCGCCTCGTGCTGGCGGACGCAGCTGGGTG
CAGAAGCTGTGGGGTCGGAGAGGCGTTTGGAGAAGGTCTGTGGTGCAGTGTGTGAAAATT
CAGGTGCTAGAAGCCTACTGGTAGAAAAACCCAAAAGGAAGAGCTATATCCTTAACCATT
CTGTCCAATTTCGGGAGCCTTGTCAGTGTGTCAGTTTTTCCTCCCCGAAGACACTCCTTC
CCCAAGTAATTGTAGGAAGATAAAAAAACTGTTACCAGATAACAAACACTGAACTCCTAT
TTGACCAGAACTTTTTCCTCTCGAGATAGTTTTTTCTTTTTAATGAAAAAAGCATAGGAA
TTGGAGATTGGCTTGTCTCACGCAGCCAGTGCACATTTGGAATTGACGGAAACAACGTTG
CTATTTCCACCCATTTGTTTTCGGCAGCCTTAAGGCCCTCATTCTCATTTCGGGTGAATC
TGTCTATCTGTGAACGTGGCCCGCATGTGCATTCTTTTTTTTATATATATAAAGTCAGTG
ACGAGGAACTCCCGAGACGTGTAATGACACCACACTTGTTTTCTTTGTTTCTTTGTTTTA
TTTAGGCAAGAAGAGGTGTGAGTAATTGAGGAAAAACTGACAGATGCTTTTGCTAATACC
AAAATTGAGCTTACAATTAGGAACTGAGTATGTGTAACAGGATACAGGTGACAGTGAAGA
TAGAAGAACCACGATGACCACAGACTCAATGTGCTCTGTAACATCGCACAGTTTACCCAG
CATGACTTTCCTTAGGAGGCCCCCTCCTCACGCTAGAGTAAAAGTCCCAGTTAAGTGAAG
CCTACCAGAAGAACTAGTAGAAGAAGCTTTGCCGCTTTTGTGCCTCTCACAGGCGCCTAA
AGTCATTGCCATGGGAGGAAGACGATTTGGGGGGGGAGGGGGGGGGGGGCAGGGTAGGTG
GGGCTTTCCCTAATTTATCTTCATGTCCAGTGAGCAGTGTTGCGTTTTTCCTTGTAGCAT
TTGGAAATGATTTACTGGAATTACAAAACCTATTTTTCCTTTAAATTTCAGCTTTGGCTC
TGGCTGCTTTTTAGAATAATGCAAGATAAAAATCACACCTGAGGGCTGAAAACGGAGAGG
GAATGGGAGACTTGATATTTAAGCAGCTTGAATGGTTTTTCTTTTCTTTATTTTTAAAGA
AATGCACTTGCCTATGATACTGTCTCTCCAGTGAAATGATTACTCCTCCATTACTCTATT
GATACAATATTGTGCATGCTAGTGTTGTATTTCTATACAGTAGCTTGAAATTGATTAACT
TATACTGTAGGTGTTATGTATTCCTATGACAAAAAAAATTAAGTCTTCAAATTTTTTAAA
GGTTTTTTTTTTTTAATTTAATTTTTCCTTTTGGGGGTAAAGTTTGCTCTACCAAATAGT
GATTGTAACAAATTGATCTGTTTTGGATGTTGCTATAGTGACATGCAGTTATATATTTTG
TTTTTAAAAGGGGGGGAGCAAAAGAAACACCAGTGTTAGCTTAATCTTAATGTCTGGTGT
TTGTCATGGTGAAATTATAACTATTACAGTGTTGGAGAACAACAAATATGTTCTCTGAAT
GAGCCTTTGTGCTTTTTGTCATGTTATGCAGTGAACTATTTTTAAGGTCTAATCAGTGAT
TATTTTTCCAGCTCCGTGTTTCTCTAAGGAATTATTTCACACACGGACCATCTTTAGCAG
TTTCCTCAGTGATGGAATATCATGAATGTGAGTCATTATGTAGCTGTCGTACATTGAGCA
AATAAACTTACAGATCTGACGCCAGTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>7532 : length: 247
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN