ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7528

Name

YY1

Synonym

DELTA|INO80S|NF-E1|UCRBP|YIN-YANG-1;YY1 transcription factor;YY1;YY1 transcription factor

Definition

INO80 complex subunit S|YY-1|Yin and Yang 1 protein|delta transcription factor|transcriptional repressor protein YY1

Position

14q

Gene Type

protein-coding

Pathways and Diseases

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

p53 pathway;PID Curated;200175

Pathway

Signaling events mediated by HDAC Class I;PID Curated;200070

Pathway

Notch-mediated HES/HEY network;PID Curated;200196

Pathway

Notch signaling pathway;PID Curated;200013

Pathway

mTOR signaling pathway;PID Curated;200080

External Links

Links to cell senescence gene database

7528

Links to epithelial mesenchymal transition gene database

7528

Links to ovarian cancer gene database

7528

Links to endometrial cancer gene database

7528

Links to iHOP

7528

Sequence Information

Nucleotide Sequence

>7528 : length: 3159
AGGGCGAACGGGCGAGTGGCAGCGAGGCGGGGCGGGCTGAGGCCAGCGCGGAAGTCTCGC
GAGGCCGGGCCCGAGCAGAGTGTGGCGGCGGCGGCGAGATCTGGGCTCGGGTTGAGGAGT
TGGTATTTGTGTGGAAGGAGGCGGAGGCGCAGGAGGAAGGGGGAAGCGGAGCGCCGGCCC
GGAGGGCGGGAGGAGGCGCGGCCAGGGCGGGCGGTTGCGGCGAGGCGAGGCGAGGCGGGG
AGCCGAGACGAGCAGCGGCCGAGCGAGCGCGGGCGCGGGCGCACCGAGGCGAGGGAGGCG
GGGAAGCCCCGCCGCCGCCGCGGCGCCCGCCCCTTCCCCCGCCGCCCGCCCCCTCTCCCC
CCGCCCGCTCGCCGCCTTCCTCCCTCTGCCTTCCTTCCCCACGGCCGGCCGCCTCCTCGC
CCGCCCGCCCGCAGCCGAGGAGCCGAGGCCGCCGCGGCCGTGGCGGCGGAGCCCTCAGCC
ATGGCCTCGGGCGACACCCTCTACATCGCCACGGACGGCTCGGAGATGCCGGCCGAGATC
GTGGAGCTGCACGAGATCGAGGTGGAGACCATCCCGGTGGAGACCATCGAGACCACAGTG
GTGGGCGAGGAGGAGGAGGAGGACGACGACGACGAGGACGGCGGCGGTGGCGACCACGGC
GGCGGGGGCGGCCACGGGCACGCCGGCCACCACCACCACCACCATCACCACCACCACCAC
CCGCCCATGATCGCTCTGCAGCCGCTGGTCACCGACGACCCGACCCAGGTGCACCACCAC
CAGGAGGTGATCCTGGTGCAGACGCGCGAGGAGGTGGTGGGCGGCGACGACTCGGACGGG
CTGCGCGCCGAGGACGGCTTCGAGGATCAGATTCTCATCCCGGTGCCCGCGCCGGCCGGC
GGCGACGACGACTACATTGAACAAACGCTGGTCACCGTGGCGGCGGCCGGCAAGAGCGGC
GGCGGCGGCTCGTCGTCGTCGGGAGGCGGCCGCGTCAAGAAGGGCGGCGGCAAGAAGAGC
GGCAAGAAGAGTTACCTCAGCGGCGGGGCCGGCGCGGCGGGCGGCGGCGGCGCCGACCCG
GGCAACAAGAAGTGGGAGCAGAAGCAGGTGCAGATCAAGACCCTGGAGGGCGAGTTCTCG
GTCACCATGTGGTCCTCAGATGAAAAAAAAGATATTGACCATGAGACAGTGGTTGAAGAA
CAGATCATTGGAGAGAACTCACCTCCTGATTATTCAGAATATATGACAGGAAAGAAACTT
CCTCCTGGAGGAATACCTGGCATTGACCTCTCAGATCCCAAACAACTGGCAGAATTTGCT
AGAATGAAGCCAAGAAAAATTAAAGAAGATGATGCTCCAAGAACAATAGCTTGCCCTCAT
AAAGGCTGCACAAAGATGTTCAGGGATAACTCGGCCATGAGAAAACATCTGCACACCCAC
GGTCCCAGAGTCCACGTCTGTGCAGAATGTGGCAAAGCTTTTGTTGAGAGTTCAAAACTA
AAACGACACCAACTGGTTCATACTGGAGAGAAGCCCTTTCAGTGCACGTTCGAAGGCTGT
GGGAAACGCTTTTCACTGGACTTCAATTTGCGCACACATGTGCGAATCCATACCGGAGAC
AGGCCCTATGTGTGCCCCTTCGATGGTTGTAATAAGAAGTTTGCTCAGTCAACTAACCTG
AAATCTCACATCTTAACACATGCTAAGGCCAAAAACAACCAGTGAAAAGAAGAGAGAAGA
CCCTTCTCGACCACGGGAAGCATCTTCCAGAAGTGTGATTGGGAATAAATATGCCTCTCC
TTTGTATATTATTTCTAGGAAGAATTTTAAAAATGAATCCTACACACCTAAGGGACATGT
TTTGATAAAGTAGTAAAAATTAAAAAAAAAAAACTTTACTAAGATGACATTGCTAAGATG
CTCTATCTTGCTCTGTAATCTCGTTTCAAAAACACAGTGTTTTTGTAAAGTGTGGTCCCA
ACAGGAGGACAATTCATGAACTTCGCATCAAAAGACAATTCTTTATACAACAGTGCTAAA
AATGGGACTTCTTTTCACATTCTTATAAATATGAAGCTCACCTGTTGCTTACAATTTTTT
TAATTTTGTATTTTCCAAGTGTGCATATTGTACACTTTTTTGGGGATATGCTTAGTAATG
CTACGTGTGATTTTTCTGGAGGTTGATAACTTTGCTTGCAGTAGATTTTCTTTAAAAGAA
TGGGCAGTTACATGCATACTTCAAAAGTATTTTCCTGTAAAAAAAAAAAAGTTATATAGG
TTTTGTTTGCTATCTTAATTTTGGTTGTATTCTTTGATGTTAACACATTTTGTATAATTG
TATCGTATAGCTGTATTGAATCATGTAGTATCAAATATTAGATGTGATTTAATAGTGTTA
ATCAATTTAAACCCATTTTAGTCACTTTTTTTTTCCAAAAAAATACTGCCAGATGCTGAT
GTTCAGTGTAATTTCTTTGCCTGTTCAGTTACAGAAAGTGGTGCTCAGTTGTAGAATGTA
TTGTACCTTTTAACACCTGATGTGTACATCCCATGTAACAGAAAGGGCAACAATAAAATA
GCAATCCTAAAGCAAGAATATGGCAGAACAAGATCTGTAAGCACAGTCTTATTTTCTTTT
GTTGTCCAGAATACTTATAATTCTTGAGCCTCCCAGAAATTGGAAGCTAAATAAAGCAAC
TCAAGTTTCCTTTATTTTGCACTCAATTACAGTGATTATTGATGAAAGCGATGCATGGAT
ATTTTAATACTTCCTACATGTCCTGACTTCTGAAAGAGAGTAGGTAACAGGCATCCCGAG
TTCAGGAACTACCTCAGAACACCCCAGGCCAGGTTGGTCATAGGCTGTGATTTTAGCCCC
CGGCAAGTGTGAGTGAAGCATCTGTACCACCGCGCAGGCTGAGCGCCTGCGCAGGGTAAG
GTGCCACCTGGCAGTGGGGCACACAGAGGGAAGACCAGGCCTGTCCATCAGCCGGCTGCC
TTCAGAGGCAGCTCCAGCAGGACCTTGGCTTGTCTGACAGGAAATGCTTGTGGTCGTTGG
TTATTTGGTTTGAGAGCCCTTGTTCCTCCATCTAGTGGAGTCCTTATTAAATGCTAGCAA
TGTGGCAATTGAGTGCCAGTAGCTTAATTTCATGTTTCT

Protein Sequence

>7528 : length: 414
MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDHG
GGGGHGHAGHHHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDG
LRAEDGFEDQILIPVPAPAGGDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKGGGKKS
GKKSYLSGGAGAAGGGGADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEE
QIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPH
KGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGC
GKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ