ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7490

Name

WT1

Synonym

AWT1|EWS-WT1|GUD|NPHS4|WAGR|WIT-2|WT33;Wilms tumor 1;WT1;Wilms tumor 1

Definition

Wilms tumor protein|amino-terminal domain of EWS|last three zinc fingers of the DNA-binding domain of WT1

Position

11p13

Gene Type

protein-coding

Pathways and Diseases

Pathway

chaperones modulate interferon signaling pathway;PID BioCarta;100016

Pathway

overview of telomerase protein component gene htert transcriptional regulation;PID BioCarta;100019

Pathway

Regulation of Telomerase;PID Curated;200072

Disease

Denys-Drash syndrome;GAD

Disease

Nephrotic syndrome, typ 4;OMIM

Disease

Alzheimer's disease;GAD

Disease

Cancer;FunDO

Disease

WAGR Syndrome;GAD

Disease

DEVELOPMENTAL;GAD

Disease

glomerulosclerosis, focal;GAD

Disease

Pleural effusion, Malignant;FunDO

Disease

Meacham syndrome;OMIM

Disease

Frasier syndrome;OMIM

Disease

Wilm's tumor;GAD

Disease

Aplastic anemia;FunDO

Disease

Yersinia infection;FunDO

Disease

Cirrhosis;FunDO

Disease

Alzheimer's disease;FunDO

Disease

wilms' tumor and congenital male genitourinary malformation;GAD

Disease

Nephritis;FunDO

Disease

Proteinuria;FunDO

Disease

Wilms tumor, type 1;OMIM

Disease

CANCER;GAD

Disease

hypospadias;GAD

Disease

Endometriosis;FunDO

Disease

NEUROLOGICAL;GAD

Disease

abnormal urogenital development;GAD

Disease

Hyperparathyroidism;FunDO

Disease

nephrotic syndrome;GAD

Disease

Urogenital abnormalities;FunDO

Disease

Denys-Drash syndrome;OMIM

Disease

RENAL;GAD

External Links

Links to cell senescence gene database

7490

Links to epithelial mesenchymal transition gene database

7490

Links to ovarian cancer gene database

7490

Links to endometrial cancer gene database

7490

Links to iHOP

7490

Sequence Information

Nucleotide Sequence

>7490 : length: 3037
AGCTGGGGTAAGGAGTTCAAGGCAGCGCCCACACCCGGGGGCTCTCCGCAACCCGACCGC
CTGTCCGCTCCCCCACTTCCCGCCCTCCCTCCCACCTACTCATTCACCCACCCACCCACC
CAGAGCCGGGACGGCAGCCCAGGCGCCCGGGCCCCGCCGTCTCCTCGCCGCGATCCTGGA
CTTCCTCTTGCTGCAGGACCCGGCTTCCACGTGTGTCCCGGAGCCGGCGTCTCAGCACAC
GCTCCGCTCCGGGCCTGGGTGCCTACAGCAGCCAGAGCAGCAGGGAGTCCGGGACCCGGG
CGGCATCTGGGCCAAGTTAGGCGCCGCCGAGGCCAGCGCTGAACGTCTCCAGGGCCGGAG
GAGCCGCGGGGCGTCCGGGTCTGAGCCGCAGCAAATGGGCTCCGACGTGCGGGACCTGAA
CGCGCTGCTGCCCGCCGTCCCCTCCCTGGGTGGCGGCGGCGGCTGTGCCCTGCCTGTGAG
CGGCGCGGCGCAGTGGGCGCCGGTGCTGGACTTTGCGCCCCCGGGCGCTTCGGCTTACGG
GTCGTTGGGCGGCCCCGCGCCGCCACCGGCTCCGCCGCCACCCCCGCCGCCGCCGCCTCA
CTCCTTCATCAAACAGGAGCCGAGCTGGGGCGGCGCGGAGCCGCACGAGGAGCAGTGCCT
GAGCGCCTTCACTGTCCACTTTTCCGGCCAGTTCACTGGCACAGCCGGAGCCTGTCGCTA
CGGGCCCTTCGGTCCTCCTCCGCCCAGCCAGGCGTCATCCGGCCAGGCCAGGATGTTTCC
TAACGCGCCCTACCTGCCCAGCTGCCTCGAGAGCCAGCCCGCTATTCGCAATCAGGGTTA
CAGCACGGTCACCTTCGACGGGACGCCCAGCTACGGTCACACGCCCTCGCACCATGCGGC
GCAGTTCCCCAACCACTCATTCAAGCATGAGGATCCCATGGGCCAGCAGGGCTCGCTGGG
TGAGCAGCAGTACTCGGTGCCGCCCCCGGTCTATGGCTGCCACACCCCCACCGACAGCTG
CACCGGCAGCCAGGCTTTGCTGCTGAGGACGCCCTACAGCAGTGACAATTTATACCAAAT
GACATCCCAGCTTGAATGCATGACCTGGAATCAGATGAACTTAGGAGCCACCTTAAAGGG
AGTTGCTGCTGGGAGCTCCAGCTCAGTGAAATGGACAGAAGGGCAGAGCAACCACAGCAC
AGGGTACGAGAGCGATAACCACACAACGCCCATCCTCTGCGGAGCCCAATACAGAATACA
CACGCACGGTGTCTTCAGAGGCATTCAGGATGTGCGACGTGTGCCTGGAGTAGCCCCGAC
TCTTGTACGGTCGGCATCTGAGACCAGTGAGAAACGCCCCTTCATGTGTGCTTACCCAGG
CTGCAATAAGAGATATTTTAAGCTGTCCCACTTACAGATGCACAGCAGGAAGCACACTGG
TGAGAAACCATACCAGTGTGACTTCAAGGACTGTGAACGAAGGTTTTCTCGTTCAGACCA
GCTCAAAAGACACCAAAGGAGACATACAGGTGTGAAACCATTCCAGTGTAAAACTTGTCA
GCGAAAGTTCTCCCGGTCCGACCACCTGAAGACCCACACCAGGACTCATACAGGTAAAAC
AAGTGAAAAGCCCTTCAGCTGTCGGTGGCCAAGTTGTCAGAAAAAGTTTGCCCGGTCAGA
TGAATTAGTCCGCCATCACAACATGCATCAGAGAAACATGACCAAACTCCAGCTGGCGCT
TTGAGGGGTCTCCCTCGGGGACCGTTCAGTGTCCCAGGCAGCACAGTGTGTGAACTGCTT
TCAAGTCTGACTCTCCACTCCTCCTCACTAAAAAGGAAACTTCAGTTGATCTTCTTCATC
CAACTTCCAAGACAAGATACCGGTGCTTCTGGAAACTACCAGGTGTGCCTGGAAGAGTTG
GTCTCTGCCCTGCCTACTTTTAGTTGACTCACAGGCCCTGGAGAAGCAGCTAACAATGTC
TGGTTAGTTAAAAGCCCATTGCCATTTGGTGTGGATTTTCTACTGTAAGAAGAGCCATAG
CTGATCATGTCCCCCTGACCCTTCCCTTCTTTTTTTATGCTCGTTTTCGCTGGGGATGGA
ATTATTGTACCATTTTCTATCATGGAATATTTATAGGCCAGGGCATGTGTATGTGTCTGC
TAATGTAAACTTTGTCATGGTTTCCATTTACTAACAGCAACAGCAAGAAATAAATCAGAG
AGCAAGGCATCGGGGGTGAATCTTGTCTAACATTCCCGAGGTCAGCCAGGCTGCTAACCT
GGAAAGCAGGATGTAGTTCTGCCAGGCAACTTTTAAAGCTCATGCATTTCAAGCAGCTGA
AGAAAAAATCAGAACTAACCAGTACCTCTGTATAGAAATCTAAAAGAATTTTACCATTCA
GTTAATTCAATGTGAACACTGGCACACTGCTCTTAAGAAACTATGAAGATCTGAGATTTT
TTTGTGTATGTTTTTGACTCTTTTGAGTGGTAATCATATGTGTCTTTATAGATGTACATA
CCTCCTTGCACAAATGGAGGGGAATTCATTTTCATCACTGGGAGTGTCCTTAGTGTATAA
AAACCATGCTGGTATATGGCTTCAAGTTGTAAAAATGAAAGTGACTTTAAAAGAAAATAG
GGGATGGTCCAGGATCTCCACTGATAAGACTGTTTTTAAGTAACTTAAGGACCTTTGGGT
CTACAAGTATATGTGAAAAAAATGAGACTTACTGGGTGAGGAAATCCATTGTTTAAAGAT
GGTCGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTTGTGTTGTGTTTTGTTTTTTAA
GGGAGGGAATTTATTATTTACCGTTGCTTGAAATTACTGTGTAAATATATGTCTGATAAT
GATTTGCTCTTTGACAACTAAAATTAGGACTGTATAAGTACTAGATGCATCACTGGGTGT
TGATCTTACAAGATATTGATGATAACACTTAAAATTGTAACCTGCATTTTTCACTTTGCT
CTCAATTAAAGTCTATTCAAAAGGAAAAAAAAAAAAA

Protein Sequence

>7490 : length: 517
MQDPASTCVPEPASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAAEASAERLQGRRSRG
ASGSEPQQMGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYGSLG
GPAPPPAPPPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPF
GPPPPSQASSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFP
NHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQ
LECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHG
VFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKP
YQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEK
PFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLAL