ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7480

Name

WNT10B

Synonym

SHFM6|WNT-12;wingless-type MMTV integration site family, member 10B;WNT10B;wingless-type MMTV integration site family, member 10B

Definition

WNT-10B protein|protein Wnt-10b

Position

12q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Disease

Split-hand/foot malformation 6;OMIM

Disease

Congenital abnormality;FunDO

Disease

Sarcoma;FunDO

Disease

Bone disease;FunDO

External Links

Links to cell senescence gene database

7480

Links to epithelial mesenchymal transition gene database

7480

Links to ovarian cancer gene database

7480

Links to endometrial cancer gene database

7480

Links to iHOP

7480

Sequence Information

Nucleotide Sequence

>7480 : length: 2370
GCGCGCGCGCGCGCGCGCGCTGGGAGGAGGGGGAGGCTGCATTCGCCTGGTCAAGGCTGG
GAGTGGAGGGTAGGGTGGGGAAGCCCCAGGCTCGGGGAGGGGCTGCAGCTCCGTCAGCCC
GGCAGAGCCACCCTGAGCTCGGTGAGAGCAAAGCCAGAGCCCCCAGTCCTTTGCTCGCCG
GCTTGCTAGCTCTCTCGATCACTCCCTCCCTTCCTCCCTCCCTTCCTCCCGGCGGCCGCG
GCGGCGCTGGGGAAGCGGTGAAGAGGAGTGGCCCGGCCCTGGAAGAATGCGGCTCTGACA
AGGGGACAGAACCCAGCGCAGTCTCCCCACGGTTTAAGCAGCACTAGTGAAGCCCAGGCA
ACCCAACCGTGCCTGTCTCGGACCCCGCACCCAAACCACTGGAGGTCCTGATCGATCTGC
CCACCGGAGCCTCCGGGCTTCGACATGCTGGAGGAGCCCCGGCCGCGGCCTCCGCCCTCG
GGCCTCGCGGGTCTCCTGTTCCTGGCGTTGTGCAGTCGGGCTCTAAGCAATGAGATTCTG
GGCCTGAAGTTGCCTGGCGAGCCGCCGCTGACGGCCAACACCGTGTGCTTGACGCTGTCC
GGCCTGAGCAAGCGGCAGCTAGGCCTGTGCCTGCGCAACCCCGACGTGACGGCGTCCGCG
CTTCAGGGTCTGCACATCGCGGTCCACGAGTGTCAGCACCAGCTGCGCGACCAGCGCTGG
AACTGCTCCGCGCTTGAGGGCGGCGGCCGCCTGCCGCACCACAGCGCCATCCTCAAGCGC
GGTTTCCGAGAAAGTGCTTTTTCCTTCTCCATGCTGGCTGCTGGGGTCATGCACGCAGTA
GCCACGGCCTGCAGCCTGGGCAAGCTGGTGAGCTGTGGCTGTGGCTGGAAGGGCAGTGGT
GAGCAGGATCGGCTGAGGGCCAAACTGCTGCAGCTGCAGGCACTGTCCCGAGGCAAGAGT
TTCCCCCACTCTCTGCCCAGCCCTGGCCCTGGCTCAAGCCCCAGCCCTGGCCCCCAGGAC
ACATGGGAATGGGGTGGCTGTAACCATGACATGGACTTTGGAGAGAAGTTCTCTCGGGAT
TTCTTGGATTCCAGGGAAGCTCCCCGGGACATCCAGGCACGAATGCGAATCCACAACAAC
AGGGTGGGGCGCCAGGTGGTAACTGAAAACCTGAAGCGGAAATGCAAGTGTCATGGCACA
TCAGGCAGCTGCCAGTTCAAGACATGCTGGAGGGCGGCCCCAGAGTTCCGGGCAGTGGGG
GCGGCGTTGAGGGAGCGGCTGGGCCGGGCCATCTTCATTGATACCCACAACCGCAATTCT
GGAGCCTTCCAGCCCCGTCTGCGTCCCCGTCGCCTCTCAGGAGAGCTGGTCTACTTTGAG
AAGTCTCCTGACTTCTGTGAGCGAGACCCCACTATGGGCTCCCCAGGGACAAGGGGCCGG
GCCTGCAACAAGACCAGCCGCCTGTTGGATGGCTGTGGCAGCCTGTGCTGTGGCCGTGGG
CACAACGTGCTCCGGCAGACACGAGTTGAGCGCTGCCATTGCCGCTTCCACTGGTGCTGC
TATGTGCTGTGTGATGAGTGCAAGGTTACAGAGTGGGTGAATGTGTGTAAGTGAGGGTCA
GCCTTACCTTGGGGCTGGGGAAGAGGACTGTGTGAGAGGGGCGCCTTTTCAGCCCTTTGC
TCTGATTTCCTTCCAAGGTCACTCTTGGTCCCTGGAAGCTTAAAGTATCTACCTGGAAAC
AGCTTTAGGGGTGGTGGGGGTCAGGTGGACTCTGGGATGTGTAGCCTTCTCCCCAACAAT
TGGAGGGTCTTGAGGGGAAGCTGCCACCCCTCTTCTGCTCCTTAGACACCTGAATGGACT
AAGATGAAATGCACTGTATTGCTCCTCCCACTTCTCAACTCCAGAGCCCCTTTAACCCTG
ATTCATACTCCTTTTGGCTGGGGAGTCCCTATAGTTTCACCACTCCTCTCCCTTGAGGGA
TAACCCCAGGCACTGTTTGGAGCCATAAGATCTGTATCTAGAAAGAGATCACCCACTCCT
ATGTACTATCCCCAAACTCCTTTACTGCAGCCTGGGCTCCCTCTTGTGGGATAATGGGAG
ACAGTGGTAGAGAGGTTTTTCTTGGGAAAGAGACAGAGTGCTGAGGGGCACTCTCCCCTG
AATCCTCAGAGAGTTGTCTGTCCAGGCCCTTAGGGAAGTTGTCTCCTTCCATTCAGATGT
TAATGGGGACCCTCCAAAGGAAGGGGTTTTCCCATGACTCTTGGAGCCTCTTTTTCCTTC
TTCAGCAGGAAGGGTGGGAAGGGATAATTTATCATACTGAGACTTGTTCTTGGTTCCTGT
TTGAAACTAAAATAAATTAAGTTACTGGAA

Protein Sequence

>7480 : length: 389
MLEEPRPRPPPSGLAGLLFLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSP
GPGSSPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK