ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7474

Name

WNT5A

Synonym

hWNT5A;wingless-type MMTV integration site family, member 5A;WNT5A;wingless-type MMTV integration site family, member 5A

Definition

WNT-5A protein|protein Wnt-5a

Position

3p21-p14

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

Noncanonical Wnt signaling pathway;PID Curated;200016

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Wnt signaling network;PID Curated;200055

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Disease

Systemic infection;FunDO

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

7474

Links to epithelial mesenchymal transition gene database

7474

Links to ovarian cancer gene database

7474

Links to endometrial cancer gene database

7474

Links to iHOP

7474

Sequence Information

Nucleotide Sequence

>7474 : length: 9795
ACTTCTCCCTGCTGCCACCTTGTGAAGAAAGTGCCTTGCTTCCCCTTTGCCTACCACCAT
GATAACCAATTTTCTTTGCGTATGCCCTTGGAGTTATTAGCTCAAAGAATAGATTTCTCT
TGGCCCACCTGGAAGCCTTCTCTTTTCCTAACTGATGACTTTGGATTATACAACTTTACC
TACTGTTAAAAGTACACAGATGAAAAGAGTAAAGGGTATTTGACTGACGAGTGAACATGA
GCTCAAAGCCAGAGTCCAAAGTGCCTCATCTGTTGGATGACAGTGCTTGGAAGCCCTGCC
AATGAAATGGCCACTGCAGAGTGTTTGTCTCCTAATGCATGTAGATGATCAGCGGGCCAC
ATAGAATACGCAATGGAAAATGCTGAGCTGTGTCACAGGACTGAACATACCAGCTGCCAT
TCATAAAACATGCCACTTAGGAGCAAACAACTTTTCAGAAGAAACAATATGACACAAGGG
GAGAGTAAATGGGATACCGTCTTTCTTCGGATGAAAACTATTTCTCTTATTAAACTCTTT
CCACTAAGGCAAGCCTTATATGGGTAAAGTGTGGTGATTAAGTCCCTTACATTTAAAGTC
AGATTACCAGGGTTCAAACTTTTGCTCAGCAGTGGCATGGCCACAGGTAAGATCATTCCT
TCATTCACTTATTTAGAACACGTTCTCTGTGTGAGTCAGTAGGGGTTTGTGTCACAACTA
TGAACAAGGCCAACCAGGTCTTGCCCTCCTGGAGCTTATTTTCTATTGAGAGAAAACAAG
ACAGACAAGTAAACAAATATACTTGTAAATAAAATAATTTTAGATCAGGATAAGACAATC
AGACAAAGCAAGGGAGTAGAGAATCATGGGGAAAAGACAGCAGCTTCTTTGAGACTGATG
TGTACAATGAGGAGGTGACTTCAAGGGAGTGAGGGTGACTGGTCAGAAGGGACAGCGTTG
CAGGCAGAGGGAAGAATAAGTACAAAGGATGCATGTGGATGAAGCTATCCTGAAGTCCAG
GTTAACTTGTTTCGATTTTATCTGATAAACTCTGGGGAGCCTCTGAAGGGCTTTAAGCAG
AGATGTGACATGACCTGAGCAGCACTGGGGAGAGACAGCCCTCAGGCCCTCATTCATTCC
TTTGGGGATAACAAGCTCTTTCCAGAGAGAAGGGAATTCCCAGGGCACTGCCCAATACAA
GGTAAGAATTCAAGGTAAATTGCTGAGTATGGATGGTGTCGTTCTTGATGGTGGCGGGGC
AAAAGCAGAGACGTCAAAGCCAGCCAGTTAATGAAATAAGAACAAATCTTTGACAGTTCC
ATTGAGCTGAGCTTGAATCAGGCGTTCCTGATGTGGCTGAATCTGGTTGTGTGCACGTCT
GGTGTTCAGTGGAGTGAAATCAGAAGGTGTCAGGATTCGCAACTCCTAAAACAGCTTGGT
TTTATCAAAATCAGGACCTCTTTGAACCTTCCTTTTCTCCACAATGCAGATAATAATACG
ATCTATCTCACAAAGTAGTGAGGATGAAACAAGGCAATGAATGTAAAGAGTTTAGACAGG
GCTAGCATCTGGCACATAGAGCTCAGTAAGTGTTGCCAGCAATTATTATGATTGTTTATT
ACCGATTATTATCTCAACACATACCTGCCCCATCTTTGTTGAATTCTGTCATATAGGCAT
GGCCGGTGATCCTATAATTGCCACATTCCTCTCCTCTTCCCAGCCCCTACCTCTACTCTC
CTCAGGCTCCTCGTTTTTCTCCAGATTCCACCAGGGGACCCAGGAACAGACATTTACAGT
GCAGAAATAATCACAGTAGCTGCCATTCATCAAGCTATCTCCATAGGCAGAGCTGGACCA
AGGTCTTTTGTACATTATCTCAATTATGAGAACAATCCTAATATATTTGTTTCCTATCTC
CACTGTAGAGGTGAGAAAATTGAGGCTCAAAAGGGTAGGTGACCACTACAGGGTCACTCA
GTCAGCAAGAGGCAGAGCTGGGATTCAGACTCACATCCATCTGACCCACAGGTTCCCTAA
AATGAAACAAAATTAAAGCATCCATTTAGTGCCCCCCCGCCACAAAGCACCATTGACTAT
GAAATGGTCATAGTCAATATAACATATAACACATAACACATAAGTGTTATATAAGGAAAG
GACACCCTATTCAACAAATGGTGCTGGGATAATTGGCATATAACACATAAGTAAGTTAGG
AGGGCATAGTGAGTGATCAGTGCAAGGAGAGCTTGAGAGTCTCAAAGAGCCTCCTGGAGT
CAACCCAGAATCCAAAAATGTCCTCTAATTTCAAAGGAGCCTTTGCCCCCCACAGGCCAG
TGGCAGCACAAAGAGATGGTATTACTTTGACGGTGGCCATGTGGTTGTGAGGAAGCCCCC
GACCCCTTTCCGGCCTCTTTGTCTTCTTTAGGGCTCCATCTGTGGCCCTGCTCACACAGC
CCTGCTGGTCTTGACTCTGAGGTGAAGGAGTAAACATCTTGGGGCTCTTTATTAGTTTAT
TTCAGAAGATGGAGCCTGTTTGCCCCTGGGGCCCATCCCTCTTTTATGGCCTCCAGGCTT
TCTTGACAAATTCTAGTGACTGGAGAGAAAACCGCTTTCTACAGCAGATCATTAAAACAC
CACCATAAACCCAGGGCCATAAAATATTATTTGCTGGGCATAAAAGGGGGGTAGATTTTC
CCAGAATGACAACCCAGGCCCTGCTTTCCCCTGCTGGGAAAGGCGGCACAGGGATGCAGT
CGTTCATAAATTCCTTATCTTGCACTCTGCTTTGTGAATAATCCGGTTGGGAGAGCAGCC
AAAAATATTGATTTATTTGTTCCACAGATTCAGAAGCATTTTTAATGAGCAGAGTGTGGT
GATGCCTTGCCAGTATATCTTCGGATGACTCAATCTGAGGCACACACCCAAATGCACACA
CGGTTTGCAAGGGGAAACATGAAGTTCCACAAACTGGAGGTCTGTCGAACATGAACCCTC
ACAGATGGAGAGGCATTGGTTTCTCTCCTTCCAACTGTCTGCTCATTTCCCAGCCAAACC
AATCAACACCATCATGGGACTGGTGCTTACAACTGAGCCTGGCTTTCTAAGGCAGTCCCC
ACCCCTACCCACTATTGAAGGGTCAAAAGGGATTTCAAGTTGGTTCTCCTTAACACCGTC
CTCTGAAATAATTCTTTCATCCATTCGCCCATTCGTGTGGTTGTTACTTCTAAGCACCTA
CTAAGTGCCAGGCATTGTTCTGAGGACTGGGGTTCCAGCCATGAAAACCGCAGATGAGGT
CCTGCTGACATGAAGCTTATTGCTCCTGGGGCATAATCTCAGCACACTAATTATTAATAT
TATCAGATAAAACAACTCTTTATCTGAAGTCCTTGGGACTAGACGGTTTTGTTGGAAATT
TTGGGAAAATAAAATGGGGCATATTGCTATTAATTTGCAAGCAGCCCAGTGAGGTCTGGG
GAAATACCCAGTAACCAAATGCATTTGTATTCATTCAGTGAAGAGTATTCCTAGCAAGTG
GAATAAATCAAGATTATGTCTTGTCATGTGAGGTCCAGTTTTACCACCACAGGAGTTTGA
AAACCTCTGTTTTCAGAGCTGCTTTTTTTCTAGAAGAGCAGGCATTGAGTGCCAGGTAAG
GGCCTGACCCATGCTAAGAGCATTCCTAGATATCGTGTTTCATTCTCAGTACTGCCCTGA
TTTTCAAGCTCATCTCATTTCATTCTCAATGCATTTCTGCAAGGTAGATCATGAAATTTC
TGCTTGCTGCTGTTGTTGCTGTTGTTGTGTGTAAGAGGGTTCTGAAGTGCTGGCTGAGAG
GCTAGACAAGGTGTGACAGCTGGAAAGTGGCAGGGCAGGGACTGGAACTCCAGATTCCAC
AGCTGGCACTCTTAACCACTAACCAACACCGACTTCCACTAGAGGAAAGACTGCAGAACA
GGAAATAGCACTGTTTGGGCTGTGTCTATACAAGCAAAGGCAATTGGAGAGAAGCAGGTG
ATTATCCAGATAACTCAGAAAATAGCCATTAAAAAATAAAGGTTTGTGGTTGGGTAGCCA
GTATTTCTAGACTGGCTGTATGTGTGGAGGAAATGCCCAGGTTAACGGCCCTTTTCTTCA
TAGAATAGGATCCTCTACACGAACTGCCTTGGACTCTGGGACACTGGGATGCTAGTTTCT
CCATTCTTCGGGAGCGCCCTTTGGCAGCCCCTTTCATAGTCAGCTCATATCCTGCCACTT
CTTGGAGCTGCTGCACGTAAGAAGTCCATTGGAATATTAAGCCCAGGAGTTGCTTTGGGG
ATGGCTGGAAGTGCAATGTCTTCCAAGTTCTTCCTAGTGGCTTTGGCCATATTTTTCTCC
TTCGCCCAGGTTGTAATTGAAGCCAATTCTTGGTGGTCGCTAGGTATGAATAACCCTGTT
CAGATGTCAGAAGTATATATTATAGGAGCACAGCCTCTCTGCAGCCAACTGGCAGGACTT
TCTCAAGGACAGAAGAAACTGTGCCACTTGTATCAGGACCACATGCAGTACATCGGAGAA
GGCGCGAAGACAGGCATCAAAGAATGCCAGTATCAATTCCGACATCGAAGGTGGAACTGC
AGCACTGTGGATAACACCTCTGTTTTTGGCAGGGTGATGCAGATAGGCAGCCGCGAGACG
GCCTTCACATACGCGGTGAGCGCAGCAGGGGTGGTGAACGCCATGAGCCGGGCGTGCCGC
GAGGGCGAGCTGTCCACCTGCGGCTGCAGCCGCGCCGCGCGCCCCAAGGACCTGCCGCGG
GACTGGCTCTGGGGCGGCTGCGGCGACAACATCGACTATGGCTACCGCTTTGCCAAGGAG
TTCGTGGACGCCCGCGAGCGGGAGCGCATCCACGCCAAGGGCTCCTACGAGAGTGCTCGC
ATCCTCATGAACCTGCACAACAACGAGGCCGGCCGCAGGACGGTGTACAACCTGGCTGAT
GTGGCCTGCAAGTGCCATGGGGTGTCCGGCTCATGTAGCCTGAAGACATGCTGGCTGCAG
CTGGCAGACTTCCGCAAGGTGGGTGATGCCCTGAAGGAGAAGTACGACAGCGCGGCGGCC
ATGCGGCTCAACAGCCGGGGCAAGTTGGTACAGGTCAACAGCCGCTTCAACTCGCCCACC
ACACAAGACCTGGTCTACATCGACCCCAGCCCTGACTACTGCGTGCGCAATGAGAGCACC
GGCTCGCTGGGCACGCAGGGCCGCCTGTGCAACAAGACGTCGGAGGGCATGGATGGCTGC
GAGCTCATGTGCTGCGGCCGTGGCTACGACCAGTTCAAGACCGTGCAGACGGAGCGCTGC
CACTGCAAGTTCCACTGGTGCTGCTACGTCAAGTGCAAGAAGTGCACGGAGATCGTGGAC
CAGTTTGTGTGCAAGTAGTGGGTGCCACCCAGCACTCAGCCCCGCTCCCAGGACCCGCTT
ATTTATAGAAAGTACAGTGATTCTGGTTTTTGGTTTTTAGAAATATTTTTTATTTTTCCC
CAAGAATTGCAACCGGAACCATTTTTTTTCCTGTTACCATCTAAGAACTCTGTGGTTTAT
TATTAATATTATAATTATTATTTGGCAATAATGGGGGTGGGAACCAAGAAAAATATTTAT
TTTGTGGATCTTTGAAAAGGTAATACAAGACTTCTTTTGATAGTATAGAATGAAGGGGAA
ATAACACATACCCTAACTTAGCTGTGTGGACATGGTACACATCCAGAAGGTAAAGAAATA
CATTTTCTTTTTCTCAAATATGCCATCATATGGGATGGGTAGGTTCCAGTTGAAAGAGGG
TGGTAGAAATCTATTCACAATTCAGCTTCTATGACCAAAATGAGTTGTAAATTCTCTGGT
GCAAGATAAAAGGTCTTGGGAAAACAAAACAAAACAAAACAAACCTCCCTTCCCCAGCAG
GGCTGCTAGCTTGCTTTCTGCATTTTCAAAATGATAATTTACAATGGAAGGACAAGAATG
TCATATTCTCAAGGAAAAAAGGTATATCACATGTCTCATTCTCCTCAAATATTCCATTTG
CAGACAGACCGTCATATTCTAATAGCTCATGAAATTTGGGCAGCAGGGAGGAAAGTCCCC
AGAAATTAAAAAATTTAAAACTCTTATGTCAAGATGTTGATTTGAAGCTGTTATAAGAAT
TAGGATTCCAGATTGTAAAAAGATCCCCAAATGATTCTGGACACTAGATTTTTTTGTTTG
GGGAGGTTGGCTTGAACATAAATGAAAATATCCTGTTATTTTCTTAGGGATACTTGGTTA
GTAAATTATAATAGTAAAAATAATACATGAATCCCATTCACAGGTTCTCAGCCCAAGCAA
CAAGGTAATTGCGTGCCATTCAGCACTGCACCAGAGCAGACAACCTATTTGAGGAAAAAC
AGTGAAATCCACCTTCCTCTTCACACTGAGCCCTCTCTGATTCCTCCGTGTTGTGATGTG
ATGCTGGCCACGTTTCCAAACGGCAGCTCCACTGGGTCCCCTTTGGTTGTAGGACAGGAA
ATGAAACATTAGGAGCTCTGCTTGGAAAACAGTTCACTACTTAGGGATTTTTGTTTCCTA
AAACTTTTATTTTGAGGAGCAGTAGTTTTCTATGTTTTAATGACAGAACTTGGCTAATGG
AATTCACAGAGGTGTTGCAGCGTATCACTGTTATGATCCTGTGTTTAGATTATCCACTCA
TGCTTCTCCTATTGTACTGCAGGTGTACCTTAAAACTGTTCCCAGTGTACTTGAACAGTT
GCATTTATAAGGGGGGAAATGTGGTTTAATGGTGCCTGATATCTCAAAGTCTTTTGTACA
TAACATATATATATATATACATATATATAAATATAAATATAAATATATCTCATTGCAGCC
AGTGATTTAGATTTACAGTTTACTCTGGGGTTATTTCTCTGTCTAGAGCATTGTTGTCCT
TCACTGCAGTCCAGTTGGGATTATTCCAAAAGTTTTTTGAGTCTTGAGCTTGGGCTGTGG
CCCTGCTGTGATCATACCTTGAGCACGACGAAGCAACCTTGTTTCTGAGGAAGCTTGAGT
TCTGACTCACTGAAATGCGTGTTGGGTTGAAGATATCTTTTTTCTTTTCTGCCTCACCCC
TTTGTCTCCAACCTCCATTTCTGTTCACTTTGTGGAGAGGGCATTACTTGTTCGTTATAG
ACATGGACGTTAAGAGATATTCAAAACTCAGAAGCATCAGCAATGTTTCTCTTTTCTTAG
TTCATTCTGCAGAATGGAAACCCATGCCTATTAGAAATGACAGTACTTATTAATTGAGTC
CCTAAGGAATATTCAGCCCACTACATAGATAGCTTTTTTTTTTTTTTTTTTAATAAGGAC
ACCTCTTTCCAAACAGTGCCATCAAATATGTTCTTATCTCAGACTTACGTTGTTTTAAAA
GTTTGGAAAGATACACATCTTTCATACCCCCCTTAGGCAGGTTGGCTTTCATATCACCTC
AGCCAACTGTGGCTCTTAATTTATTGCATAATGATATTCACATCCCCTCAGTTGCAGTGA
ATTGTGAGCAAAAGATCTTGAAAGCAAAAAGCACTAATTAGTTTAAAATGTCACTTTTTT
GGTTTTTATTATACAAAAACCATGAAGTACTTTTTTTATTTGCTAAATCAGATTGTTCCT
TTTTAGTGACTCATGTTTATGAAGAGAGTTGAGTTTAACAATCCTAGCTTTTAAAAGAAA
CTATTTAATGTAAAATATTCTACATGTCATTCAGATATTATGTATATCTTCTAGCCTTTA
TTCTGTACTTTTAATGTACATATTTCTGTCTTGCGTGATTTGTATATTTCACTGGTTTAA
AAAACAAACATCGAAAGGCTTATGCCAAATGGAAGATAGAATATAAAATAAAACGTTACT
TGTATATTGGTAAGTGGTTTCAATTGTCCTTCAGATAATTCATGTGGAGATTTTTGGAGA
AACCATGACGGATAGTTTAGGATGACTACATGTCAAAGTAATAAAAGAGTGGTGAATTTT
ACCAAAACCAAGCTATTTGGAAGCTTCAAAAGGTTTCTATATGTAATGGAACAAAAGGGG
AATTCTCTTTTCCTATATATGTTCCTTACAAAAAAAAAAAAAAAAGAAATCAAGCAGATG
GCTTAAAGCTGGTTATAGGATTGCTCACATTCTTTTAGCATTATGCATGTAACTTAATTG
TTTTAGAGCGTGTTGCTGTTGTAACATCCCAGAGAAGAATGAAAAGGCACATGCTTTTAT
CCGTGACCAGATTTTTAGTCCAAAAAAATGTATTTTTTTGTGTGTTTACCACTGCAACTA
TTGCACCTCTCTATTTGAATTTACTGTGGACCATGTGTGGTGTCTCTATGCCCTTTGAAA
GCAGTTTTTATAAAAAGAAAGCCCGGGTCTGCAGAGAATGAAAACTGGTTGGAAACTAAA
GGTTCATTGTGTTAAGTGCAATTAATACAAGTTATTGTGCTTTTCAAAAATGTACACGGA
AATCTGGACAGTGCTCCACAGATTGATACATTAGCCTTTGCTTTTTCTCTTTCCGGATAA
CCTTGTAACATATTGAAACCTTTTAAGGATGCCAAGAATGCATTATTCCACAAAAAAACA
GCAGACCAACATATAGAGTGTTTAAAATAGCATTTCTGGGCAAATTCAAACTCTTGTGGT
TCTAGGACTCACATCTGTTTCAGTTTTTCCTCAGTTGTATATTGACCAGTGTTCTTTATT
GCAAAAACATATACCCGATTTAGCAGTGTCAGCGTATTTTTTCTTCTCATCCTGGAGCGT
ATTCAAGATCTTCCCAATACAAGAAAATTAATAAAAAATTTATATATAGGCAGCAGCAAA
AGAGCCATGTTCAAAATAGTCATTATGGGCTCAAATAGAAAGAAGACTTTTAAGTTTTAA
TCCAGTTTATCTGTTGAGTTCTGTGAGCTACTGACCTCCTGAGACTGGCACTGTGTAAGT
TTTAGTTGCCTACCCTAGCTCTTTTCTCGTACAATTTTGCCAATACCAAGTTTCAATTTG
TTTTTACAAAACATTATTCAAGCCACTAGAATTATCAAATATGACGCTATAGCAGAGTAA
ATACTCTGAATAAGAGACCGGTACTAGCTAACTCCAAGAGATCGTTAGCAGCATCAGTCC
ACAAACACTTAGTGGCCCACAATATATAGAGAGATAGAAAAGGTAGTTATAACTTGAAGC
ATGTATTTAATGCAAATAGGCACGAAGGCACAGGTCTAAAATACTACATTGTCACTGTAA
GCTATACTTTTAAAATATTTATTTTTTTTAAAGTATTTTCTAGTCTTTTCTCTCTCTGTG
GAATGGTGAAAGAGAGATGCCGTGTTTTGAAAGTAAGATGATGAAATGAATTTTTAATTC
AAGAAACATTCAGAAACATAGGAATTAAAACTTAGAGAAATGATCTAATTTCCCTGTTCA
CACAAACTTTACACTTTAATCTGATGATTGGATATTTTATTTTAGTGAAACATCATCTTG
TTAGCTAACTTTAAAAAATGGATGTAGAATGATTAAAGGTTGGTATGATTTTTTTTTAAT
GTATCAGTTTGAACCTAGAATATTGAATTAAAATGCTGTCTCAGTATTTTAAAAGCAAAA
AAGGAATGGAGGAAAATTGCATCTTAGACCATTTTTATATGCAGTGTACAATTTGCTGGG
CTAGAAATGAGATAAAGATTATTTATTTTTGTTCATATCTTGTACTTTTCTATTAAAATC
ATTTTATGAAATCCA

Protein Sequence

>7474 : length: 380
MKKSIGILSPGVALGMAGSAMSSKFFLVALAIFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK