ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7473

Name

WNT3

Synonym

INT4|TETAMS;wingless-type MMTV integration site family, member 3;WNT3;wingless-type MMTV integration site family, member 3

Definition

WNT-3 proto-oncogene protein|proto-oncogene Int-4 homolog|proto-oncogene Wnt-3

Position

17q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Pathway

Wnt signaling network;PID Curated;200055

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Disease

Embryoma;FunDO

Disease

Tetra-amelia, autosomal recessive;OMIM

External Links

Links to cell senescence gene database

7473

Links to epithelial mesenchymal transition gene database

7473

Links to ovarian cancer gene database

7473

Links to endometrial cancer gene database

7473

Links to iHOP

7473

Sequence Information

Nucleotide Sequence

>7473 : length: 3385
TGCTCCGCGCTGGGCTCGGGAGGGGGGCGGCTGCGGGTGGAGGTGCGCTTCTGACAAGCC
CGAAAGTCATTTCCAATCTCAAGTGGACTTTGTTCCAACTATTGGGGGCGTCGCTCCCCC
TCTTCATGGTCGCGGGCAAACTTCCTCCTCGGCGCCTCTTCTAATGGAGCCCCACCTGCT
CGGGCTGCTCCTCGGCCTCCTGCTCGGTGGCACCAGGGTCCTCGCTGGCTACCCAATTTG
GTGGTCCCTGGCCCTGGGCCAGCAGTACACATCTCTGGGCTCACAGCCCCTGCTCTGCGG
CTCCATCCCAGGCCTGGTCCCCAAGCAACTGCGCTTCTGCCGCAATTACATCGAGATCAT
GCCCAGCGTGGCCGAGGGCGTGAAGCTGGGCATCCAGGAGTGCCAGCACCAGTTCCGGGG
CCGCCGCTGGAACTGCACCACCATAGATGACAGCCTGGCCATCTTTGGGCCCGTCCTCGA
CAAAGCCACCCGCGAGTCGGCCTTCGTTCACGCCATCGCCTCGGCCGGCGTGGCCTTCGC
CGTCACCCGCTCCTGCGCCGAGGGCACCTCCACCATTTGCGGCTGTGACTCGCATCATAA
GGGGCCGCCTGGCGAAGGCTGGAAGTGGGGCGGCTGCAGCGAGGACGCTGACTTCGGCGT
GTTAGTGTCCAGGGAGTTCGCGGATGCGCGCGAGAACAGGCCGGACGCGCGCTCGGCCAT
GAACAAGCACAACAACGAGGCGGGCCGCACGACTATCCTGGACCACATGCACCTCAAATG
CAAGTGCCACGGGCTGTCGGGCAGCTGTGAGGTGAAGACCTGCTGGTGGGCGCAGCCTGA
CTTCCGTGCCATCGGTGACTTCCTCAAGGACAAGTATGACAGCGCCTCGGAGATGGTAGT
AGAGAAGCACCGTGAGTCCCGAGGCTGGGTGGAGACCCTCCGGGCCAAGTACTCGCTCTT
CAAGCCACCCACGGAGAGGGACCTGGTCTACTACGAGAACTCCCCCAACTTTTGTGAGCC
CAACCCAGAGACGGGTTCCTTTGGCACAAGGGACCGGACTTGCAATGTCACCTCCCACGG
CATCGATGGCTGCGATCTGCTCTGCTGTGGCCGGGGCCACAACACGAGGACGGAGAAGCG
GAAGGAAAAATGCCACTGCATCTTCCACTGGTGCTGCTACGTCAGCTGCCAGGAGTGTAT
TCGCATCTACGACGTGCACACCTGCAAGTAGGGCACCAGGGCGCTGGGAAGGGGTGAAGT
GTGTGGCTGGGCGGATTCAGCGAAGTCTCATGGGAAGCAGGACCTAGAGCCGGGCACAGC
CCTCAGCGTCAGACAGCAAGGAACTGTCACCAGCCGCACGCGTGGTAAATGACCCAGACC
CAACTCGCCTGTGGACGGGGAGGCTCTCCCTCTCTCTCATCTTACATTTCTCACCCTACT
CTGGATGGTGTGTGGTTTTTAAAGAAGGGGGCTTTCTTTTTAGTTCTCTAGGGTCTGATA
GGAACAGACCTGAGGCTTATCTTTGCACATGTTAAAGAAAATAAAAATGAAAAAAAATTT
GACTCCAACAGAACAGGCTGGGCTAATGTGAGCTCTCAGCCTGGCAGTCAAGACATCAGC
ATGGGCAAGGTTCTGTTTCCAAACTGCTGCTTCTGGTGACATTCCAAGACGCCTGGAGGG
TGGGAGTCAGGAAGTAGGACACACCCCTGCAGTCTCCTTTTCTTGGTCCACTCCCATTCA
AATTTGAGCTAATTTCTCATTCTGATAAAAGCCATAGGTTTAGCTAGGATGAAGTGGTAG
GAAGGTCCGTGGCAGTTGTTAGAGTAGGATTTGGAGTTTGGAAGAACTGGCAGCTCAGGG
TGGCCTGGTCAGCCGTTTGAAGAGCAGCCATGTGTTCTTCTCAGTCTCATTTTCTCTATA
ACCCTGTTCTGCACGAGGGGCAGTCAGATCTCAAAATCTTTTTCTACCATTCTGCAGTTT
CCACCGTCAATGCAGTTTTTTTTTTGTTTTTTTGTTTTTTTTTTTTTTTGGTGGTAGTGG
ACCTTGTAAATAGGCTATGTAAGGGGGCAAGTCTTCTCTAGCTCAAATGGCTTCCTAAAT
AAATAAGCGGTATCTTCAGAAGGGGCCATTCAGTCCTTCCCAGCCCTGCTCACCTGCAGA
TTCTCTGTACAAATAACTCCAGGTAGAGCAGTTGGACTCCAGGTCACCTTAGTATAAGTT
AGACAAAGGGTCCGTGAGGGAGTAGCCATCAATTCCTGAAATTCCAACTTTGTGACTAGC
AGATGGGGAGGATGAAAACCATCCCTTTGCTTCCTCTCCAATACGGACCCATCTTACTGT
GTCCTTTCCTCTCTGGGGCCAATGTGAGTAAACACAGACACAGAGTTCTTTCCCCCAGCT
CTTCCTCCCTCACCTGCATGCTGAGATAGCTTCCATCCATGCAGTTCCCAAGGATCTGGA
TTAGAAGTTCAAAGGGGAACCAGCAGTCACCTACTCCCTTAGGTGAAGCATCTCACGGCT
GAGTTCTCCCTGAGGCATACTGGTCCAGCTGAGCGTCCTAGAGAAAGCTAGCAAAAGGGA
GGCACATGGATTTCACAGTATGAATTGGTTCAACAACTGTCTTAGGGAGAATCAGAAAGA
AGAGATGCAGCAGGGGAATGAGCAGAACAAAGATTTTTCTTTCTCCCCCTTCTCTCTGGG
GTCTACCTAACCCTGACCTAAAATACCAGGGCAGCGATCTCCCAGCTGGTGCAGGTGGGC
TTGCCAAGATGGTCGTCCAGGAGCCCGCCTTCACTTCTAAATCTGCTGGCCACAAGCCCT
GCTAAAGATACACATCTCACCCCCTCCGCCAAGTCTGAAATGCCCCTCCCCATCTCACCT
TAGACTGAAAAGTTTTAAATCATGTCAACTGGATAATACTTGCTTTATGTGAGAATACTT
CAGCAGAATGGATACGAATTTTCAAAACAATCTTTTCATATCTATGTATTCTATATTAAA
AGTGATAAAGTCATGTTTCTGGGGCGTATTCAAGTAGCTGACAAGTAATTATTTAATAAT
AGTACATGAGTGCATTGTAATGATTCTCGCCGTAGTCAGGTAATAGTATCCAACCGAAAT
TTCCTACCAACCTGCTGTATCCAAAGTTTTGTAAAAAGTTGTAGAAGTTGTTGATCTTTT
TGATTTTATATTCAAAAAGTCTCTTTTTATAAATATTATTTATTATACAATGTATATACC
TTTGAGTTAACTAAGATTATATATTATATAAATATATATATATTTGGAGAAAATATATTT
CATCATGCAGTTTTTTTCTGTTAAGTCATTAAAGAGAAGGTAAACAAACCTAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>7473 : length: 355
MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK