ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7472

Name

WNT2

Synonym

INT1L1|IRP;wingless-type MMTV integration site family member 2;WNT2;wingless-type MMTV integration site family member 2

Definition

Int-1-related protein|int-1-like protein 1|protein Wnt-2|secreted growth factor

Position

7q31.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Wnt signaling network;PID Curated;200055

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Disease

Autistic disorder;FunDO

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

7472

Links to epithelial mesenchymal transition gene database

7472

Links to ovarian cancer gene database

7472

Links to endometrial cancer gene database

7472

Links to iHOP

7472

Sequence Information

Nucleotide Sequence

>7472 : length: 2907
AGCAGAGCGGACGGGGCGCGCGGGAGGCGCGCAGAGCTTTCGGGCTGCAGGCGCTCGCTG
CGCCTGGGGAATTGGGCTGTGGGCGAGGCGGTCCGGGCTGGCCTTTATCGCTCGCTGGGC
CCATCGTTTGAAACTTTATCAGCGAGTCTCGCCACTCGTCGCAGACGCGAGCGGGGGGCG
GGGGCGCGGCGAGGCGCCGGCGGCCGTGACGAGGCGCTCCCGGAGCTGAGCGCTTCTGCT
CTGGGCACGCATGGCGCCCGCACACGGAGTCTGACCTGATGCAGACGCAAGGGGGTTAAT
ATGAACGCCCCTCTCGGTGGAATCTGGCTCTGGCTCCCTCTGCTCTTGACCTGGCTCACC
CCCGAGGTCAACTCTTCATGGTGGTACATGAGAGCTACAGGTGGCTCCTCCAGGGTGATG
TGCGATAATGTGCCAGGCCTGGTGAGCAGCCAGCGGCAGCTGTGTCACCGACATCCAGAT
GTGATGCGTGCCATTAGCCAGGGCGTGGCCGAGTGGACAGCAGAATGCCAGCACCAGTTC
CGCCAGCACCGCTGGAATTGCAACACCCTGGACAGGGATCACAGCCTTTTTGGCAGGGTC
CTACTCCGAAGTAGTCGGGAATCTGCCTTTGTTTATGCCATCTCCTCAGCTGGAGTTGTA
TTTGCCATCACCAGGGCCTGTAGCCAAGGAGAAGTAAAATCCTGTTCCTGTGATCCAAAG
AAGATGGGAAGCGCCAAGGACAGCAAAGGCATTTTTGATTGGGGTGGCTGCAGTGATAAC
ATTGACTATGGGATCAAATTTGCCCGCGCATTTGTGGATGCAAAGGAAAGGAAAGGAAAG
GATGCCAGAGCCCTGATGAATCTTCACAACAACAGAGCTGGCAGGAAGGCTGTAAAGCGG
TTCTTGAAACAAGAGTGCAAGTGCCACGGGGTGAGCGGCTCATGTACTCTCAGGACATGC
TGGCTGGCCATGGCCGACTTCAGGAAAACGGGCGATTATCTCTGGAGGAAGTACAATGGG
GCCATCCAGGTGGTCATGAACCAGGATGGCACAGGTTTCACTGTGGCTAACGAGAGGTTT
AAGAAGCCAACGAAAAATGACCTCGTGTATTTTGAGAATTCTCCAGACTACTGTATCAGG
GACCGAGAGGCAGGCTCCCTGGGTACAGCAGGCCGTGTGTGCAACCTGACTTCCCGGGGC
ATGGACAGCTGTGAAGTCATGTGCTGTGGGAGAGGCTACGACACCTCCCATGTCACCCGG
ATGACCAAGTGTGGGTGTAAGTTCCACTGGTGCTGCGCCGTGCGCTGTCAGGACTGCCTG
GAAGCTCTGGATGTGCACACATGCAAGGCCCCCAAGAACGCTGACTGGACAACCGCTACA
TGACCCCAGCAGGCGTCACCATCCACCTTCCCTTCTACAAGGACTCCATTGGATCTGCAA
GAACACTGGACCTTTGGGTTCTTTCTGGGGGGATATTTCCTAAGGCATGTGGCCTTTATC
TCAACGGAAGCCCCCTCTTCCTCCCTGGGGGCCCCAGGATGGGGGGGCCACACGCTGCAC
CTAAAGCCTACCCTATTCTATCCATCTCCTGGTGTTCTGCAGTCATCTCCCCTCCTGGCG
AGTTCTCTTTGGAAATAGCATGACAGGCTGTTCAGCCGGGAGGGTGGTGGGCCCAGACCA
CTGTCTCCACCCACCTTGACGTTTCTTCTTTCTAGAGCAGTTGGCCAAGCAGAAAAAAAA
GTGTCTCAAAGGAGCTTTCTCAATGTCTTCCCACAAATGGTCCCAATTAAGAAATTCCAT
ACTTCTCTCAGATGGGAACAGTAAAGAAAGCAGAATCAACTGCCCCTGACTTAACTTTAA
CTTTTGAAAAGACCAAGACTTTTGTCTGATCAAGTGGTTTTACAGCTACCACCCTTAGGG
GTAATTGGTAATTACCTGGAGAAGAATGGCTTTCAATACCCTTTTAAGTTTAAAATGTGT
ATTTTTCAAGGCATTTATTGCCATATTAAAATCTGATGTAACAAGGTGGGGACGTGTGTC
CTTTGGTACTATGGTGTGTTGTATCTTTGTAAGAGCAAAAGCCTCAGAAAGGGATTGCTT
TGCATTACTGTCCCCTTGATATAAAAAATCTTTAGGGAATGAGAGTTCCTTCTCACTTAG
AATCCGAAGGGAATTAAAAAGAAGATGAATGGTCTGGCAATATTCTGTAACTATTGGGTG
AATATGGTGGAAAATAATTTAGTGGATGGAATATCAGAAGTATATCTGTACAGATCAAGA
AAAAAAGGGAGAATAAAATTCCTATCTCATATTATGCATGTGACCCATGGAATCTCATAA
CTGAAAGACTTGAAGGATGAAAATTTTGGGGATACAAGATTGGTGAACTAAAATGCTGAC
AGAGAGGTTTCCAGAGCTAACTCGTGCCTGGGGCGGCCTTACAATAAGCAGATGCCTGAA
AGAAGTCGGCCACGTCCGCCGTCTGCTAATGCCCATCACCCTTCAAGCCCAGTTTAAAGA
CCTGTCATATTTAATTGTATTTATTTGATGCTTACAAGATGATGTGATACTGTAGCCTAA
AGCAAATGACACATAGCATTGCTTATAAAGTTGGTAACCCTGCTATATTATATTGCAAAC
AAATCGTAACTTGGAGACTATGTTTAAGGGACTCAACTGTAATTATGGGAGCATCAGTAT
GCAAATAGTGGTTGGCTTCTGCCATCAGCCAAAAGATGACATTCAGGGAAAATGGAGAGG
CTGCCTGCACCGTTTTTTTATGTTAAATGAAAGAAAGGTGAAATAGCTACTTCTCGTCTT
CTTGAAAAATTTGGTTCTTATTCTGTATATGACTTCCTTACAGTGCTACATTAACAGGAT
ATTTCATTACATGCATCTGGTATCAAA

Protein Sequence

>7472 : length: 360
MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPD
VMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKAPKNADWTTAT