ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7471

Name

WNT1

Synonym

BMND16|INT1|OI15;wingless-type MMTV integration site family, member 1;WNT1;wingless-type MMTV integration site family, member 1

Definition

proto-oncogene Int-1 homolog|proto-oncogene Wnt-1|wingless-type MMTV integration site family, member 1 (oncogene INT1)

Position

12q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152

Pathway

multi-step regulation of transcription by pitx2;PID BioCarta;100074

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Angiogenesis;PANTHER;P00005

Pathway

wnt signaling pathway;PID BioCarta;100002

Pathway

Wnt signaling network;PID Curated;200055

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

segmentation clock;PID BioCarta;100146

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Disease

Cancer;FunDO

Disease

Systemic scleroderma;FunDO

Disease

Neurodegenerative disorder;FunDO

External Links

Links to cell senescence gene database

7471

Links to epithelial mesenchymal transition gene database

7471

Links to ovarian cancer gene database

7471

Links to endometrial cancer gene database

7471

Links to iHOP

7471

Sequence Information

Nucleotide Sequence

>7471 : length: 2284
GCGGTGCCGCCCGCCGTGGCCGCCTCAGCCCACCAGCCGGGACCGCGAGCCATGCTGTCC
GCCGCCCGCCCCCAGGGTTGTTAAAGCCAGACTGCGAACTCTCGCCACTGCCGCCACCGC
CGCGTCCCGTCCCACCGTCGCGGGCAACAACCAAAGTCGCCGCAACTGCAGCACAGAGCG
GGCAAAGCCAGGCAGGCCATGGGGCTCTGGGCGCTGTTGCCTGGCTGGGTTTCTGCTACG
CTGCTGCTGGCGCTGGCCGCTCTGCCCGCAGCCCTGGCTGCCAACAGCAGTGGCCGATGG
TGGGGTATTGTGAACGTAGCCTCCTCCACGAACCTGCTTACAGACTCCAAGAGTCTGCAA
CTGGTACTCGAGCCCAGTCTGCAGCTGTTGAGCCGCAAACAGCGGCGTCTGATACGCCAA
AATCCGGGGATCCTGCACAGCGTGAGTGGGGGGCTGCAGAGTGCCGTGCGCGAGTGCAAG
TGGCAGTTCCGGAATCGCCGCTGGAACTGTCCCACTGCTCCAGGGCCCCACCTCTTCGGC
AAGATCGTCAACCGAGGCTGTCGAGAAACGGCGTTTATCTTCGCTATCACCTCCGCCGGG
GTCACCCATTCGGTGGCGCGCTCCTGCTCAGAAGGTTCCATCGAATCCTGCACGTGTGAC
TACCGGCGGCGCGGCCCCGGGGGCCCCGACTGGCACTGGGGGGGCTGCAGCGACAACATT
GACTTCGGCCGCCTCTTCGGCCGGGAGTTCGTGGACTCCGGGGAGAAGGGGCGGGACCTG
CGCTTCCTCATGAACCTTCACAACAACGAGGCAGGCCGTACGACCGTATTCTCCGAGATG
CGCCAGGAGTGCAAGTGCCACGGGATGTCCGGCTCATGCACGGTGCGCACGTGCTGGATG
CGGCTGCCCACGCTGCGCGCCGTGGGCGATGTGCTGCGCGACCGCTTCGACGGCGCCTCG
CGCGTCCTGTACGGCAACCGCGGCAGCAACCGCGCTTCGCGGGCGGAGCTGCTGCGCCTG
GAGCCGGAAGACCCGGCCCACAAACCGCCCTCCCCCCACGACCTCGTCTACTTCGAGAAA
TCGCCCAACTTCTGCACGTACAGCGGACGCCTGGGCACAGCAGGCACGGCAGGGCGCGCC
TGTAACAGCTCGTCGCCCGCGCTGGACGGCTGCGAGCTGCTCTGCTGCGGCAGGGGCCAC
CGCACGCGCACGCAGCGCGTCACCGAGCGCTGCAACTGCACCTTCCACTGGTGCTGCCAC
GTCAGCTGCCGCAACTGCACGCACACGCGCGTACTGCACGAGTGTCTGTGAGGCGCTGCG
CGGACTCGCCCCCAGGAACGCTCTCCTCGAGCCCTCCCCCAAACAGACTCGCTAGCACTC
AAGACCCGGTTATTCGCCCACCCGAGTACCTCCAGTCACACTCCCCGCGGTTCATACGCA
TCCCATCTCTCCCACTTCCTCCTACCTGGGGACTCCTCAAACCACTTGCCTGGGGCGGCA
TGAACCCTCTTGCCATCCTGATGGACCTGCCCCGGACCTACCTCCCTCCCTCTCCGCGGG
AGACCCCTTGTTGCACTGCCCCCTGCTTGGCCAGGAGGTGAGAGAAGGATGGGTCCCCTC
CGCCATGGGGTCGGCTCCTGATGGTGTCATTCTGCCTGCTCCATCGCGCCAGCGACCTCT
CTGCCTCTCTTCTTCCCCTTTGTCCTGCGTTTTCTCCGGGTCCTCCTAAGTCCCTTCCTA
TTCTCCTGCCATGGGTGCAGACCCTGAACCCACACCTGGGCATCAGGGCCTTTCTCCTCC
CCACCTGTAGCTGAAGCAGGAGGTTACAGGGCAAAAGGGCAGCTGTGATGATGTGGAAAT
GAGGTTGGGGGAACCAGCAGAAATGCCCCCATTCTCCCAGTCTCTGTCGTGGAGCCATTG
AACAGCTGTGAGCCATGCCTCCCTGGGCCACCTCCTACCCCTTCCTGTCCTGCCTCCTCA
TCAGTGTGTAAATAATTTGCACTGAAACGTGGATACAGAGCCACGAGTTTGGATGTTGTA
AATAAAACTATTTATTGTGCTGGGTCCCAGCCTGGTTTGCAAAGACCACCTCCAACCCAA
CCCAATCCCTCTCCACTCTTCTCTCCTTTCTCCCTGCAGCCTTTTCTGGTCCCTCTTCTC
TCCTCAGTTTCTCAAAGATGCGTTTGCCTCCTGGAATCAGTATTTCCTTCCACTGTAGCT
ATTAGCGGCTCCTCGCCCCCACCAGTGTAGCATCTTCCTCTGCAGAATAAAATCTCTATT
TTTA

Protein Sequence

>7471 : length: 370
MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL