ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7468

Name

WHSC1

Synonym

MMSET|NSD2|REIIBP|TRX5|WHS;Wolf-Hirschhorn syndrome candidate 1;WHSC1;Wolf-Hirschhorn syndrome candidate 1

Definition

IL5 promoter REII region-binding protein|histone-lysine N-methyltransferase NSD2|multiple myeloma SET domain containing protein type III|nuclear SET domain-containing protein 2|probable histone-lysine N-methyltransferase NSD2|trithorax/ash1-related protei

Position

4p16.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Lysine degradation;KEGG PATHWAY;hsa00310

Disease

Multiple myeloma;KEGG DISEASE;H00010

Disease

Cancers;KEGG DISEASE

Disease

Wolf-Hirschorn syndrome;OMIM

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Multiple myeloma;FunDO

Disease

Leukemia;FunDO

External Links

Links to cell senescence gene database

7468

Links to epithelial mesenchymal transition gene database

7468

Links to ovarian cancer gene database

7468

Links to endometrial cancer gene database

7468

Links to iHOP

7468

Sequence Information

Nucleotide Sequence

>7468 : length: 8566
CTGTCTGCTTTTCTGTGGAGACTGCGGGTTGCAGACACCAGCAGCCCCCTATTGCTGCAC
GTCAGGTGTCCTCCACCTCAGTACTGTGGACATCTCGGGCCGCATAGCCCTGTTGCGCGG
GCATCCTGTGCGTTGCAGGAGATGCAGCAGCATCCATGACCGCAACCCATCAGAGTGTTC
TAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTT
CAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAAC
GGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAG
CTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCC
TTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGC
GCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCT
AACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAACATAC
ATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCT
CAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGC
ATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATC
TCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGA
GACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGT
TACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTCACAGCTATACCAAACTT
AAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAA
AGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAA
TTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAA
CCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCT
GCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAG
CTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAA
ATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAA
GAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTG
GAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGA
AGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGG
AAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTA
GCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGT
CTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTC
CAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATA
CAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGACGGAC
AAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTAC
AAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGAT
GCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGG
TTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGCTTTTGTGGGAGCCC
ACACCAGTCAAGTTGGATTTGAACCCAGCTGCTCTGTACTGCACTTAGAATGATGTAATA
TTCCAGGATGCTGCTGCAGGTGGCGTATCATCGTACACACTCAGTGACATTTCTATCACA
ATCATTTTATGGAAGATGTGTGATAATCTGTTTTTACTGGTATTAATAAACACATACAAT
GAAGAAAACAGATAACAAATTTTAAGACCAAGGTAAGATAACTAATCAAGGCCATTTAAT
CCGTCACATTCATCTCATAATAGAAACACGTTCATATTCCAGTGGTCAATGTAGATTTCA
AGTTGAAAGGCAGTCCCTTTAGTTGGGGGCTGTCCAGAGCTGCAGCAGGGCTTTGCACGG
AAGGGGTGGCCCTGTTAGAGTTGCTTCTCCTCTAGTTTGTAACTTACTGGACTTTTGTGG
AAAATATCAGCGTCGCTACCCTCAGAAACAAACTAACAGCACACGTTAGGAGGAGTCCTC
ATCAGCTGTTCTCATTGCCAGTGAGATATATTCAGTATTGTAGATACTACACTAATTTCC
AACATAAGAGGCAGGAAGAGTTTTGATTCTATCCTTTTTTACTAAACAGTTTTATTATGA
CACTAGATACAGTAAATTTTTAGAAAAAAATACCATTTACAGTATTATTGTGAACCATTT
AACCCTTTTGATCCAAGGCCCCGGACCAAGGGGATACTGTAATCAGGTTATGTACACCAA
CCTCTGCATCAGTTGCTTCTATAGAGCATCAGCCCTCATGTTTCATTGTCTTAATGTCGG
GGAGCAGCCTGGTGTCCTGCCCCAGGTGTCCGCATTTTTGCATGGTAAGGAAAAGGCTTA
CTTGCCCTTCAGCTCATAAAAGCAGAAGGTGTGCTATTCACAGTACCATGCGAGTAGCCC
ACAGTTAATTCCCGGCAGATTCTTTGGCTGTGTTTTATCTTTAATGAACGTTTCTGACTA
ATATTTTGTTGTAAACCATTAAGTAATGTAACGCATGTAAGATGCTTAGGGTGCCTGGCC
AGGACTCCGTGGTTTCCTGTTGTGACAGTAATAATGGTTATAATAATAAAAATGATAAAA
TTGCCATCATTCTATTTTTATCCAAAAGTATAAATTTTGCTTTGGCATGAAAAGTGGTCC
TCTTGACTGCATTATGCATGCGAGGATGAAATAAACCTAGAAGTGGCAGAACACTGGATT
TGTGTGTGTGGCGCTTTAGGGTGCTGGACTGTATGGCTGAGGGCTGGTTGGGTTCCTCTA
TTGGCTCTGCTCAAATGTTGCAGGATACATAGCCCCAAAGATGGTCTAGGAGCAATCTAA
GCTGTGTTACTCCAAAGGACATGAAAAAGCTCAAGAGTAAAATTAAAATTCTCAAAAAAA
AACCCCACGAAATTTAAAGATGGGGAAAAAAAGATGGTATAAAAATGGCTCTGGTTCAAT
AAGCAGTCACCCAAAGTAAAGACTCTATCTTGAAAGGCTTTTGGTGAAAATGAAGGGATT
TCATTTGAAATTACAGCATGATGAATTTTGCATGGGTGGCCAGCCAGCTAGCCCATAACT
GATAGATGCATTAGAAGTCAGCCAGCGCATAGGTGCTCCCTCTATATTATGGAGAAAGCA
AAACCCTGCAAATGACCAAATGGTGTCCAAAGAGCAGCATGACATTGGCATCAGCTGAAT
AACCAGGGGCACATGGGGGAACGTGGATGGGAATGATAGTGTATCTCAGCGGGGGGTGGG
GTGACATCGTTCCCTGGGGACATTGGGAAGGTGGGCAGGGGCAAGTGAACTCAGCACTCT
GCAGTGAGAGGGACAGTCCCATGTGTGGCAGCATTGTCCCACTTCAGATGCCAGGAGTGG
GCTCATCCTAGAGGAGCGGAGTTTTCCGAGAGGACCATCTCCTGGTTTCCTGAAGGAGGT
GGGTGGAAACGGCTCTTGTTTGAAAGAACTTAGGGAGGACCATTGGCTTGCCAAGAGTAC
AGAAATTCATTATGCTGCTAATTTAACGTGGAATTCCTTCATTTCATAAGAACCTCAAAA
TAATGGTGATACATTCTAGCCTTAAGACATTTGAATTGCCGGTTGTTGAGGTGAATTTTG
TTTGTCATACATGGAACCATTTTAGTCCCATTTGACTCACTTCAGACCATCTTCCACACA
CTATGTCTGTGCTTGGAGAGGGGAGGTGGCTCTCCAGTGTAAAACTTGAGGCATTCACTA
GAGGTGAAAACTTGTCAGAATATATAAAAGCTTAGATTGTAGCTGTTCTAAAAACGTAAG
TACTCCATTGTAATAGGGTGGCATCTTCAGGTAGTGCACATATTGGCAATAGAGGTCCTG
AATTGTTTTTCTAAGACTGATCTGAGAGCCATTGGGCCATCAAGCCTTTATATATCTGCT
TCTAAAATTGCCCCACCTGCTCTAGATGGATCTTTGGGCCTTTCCTCAGTGTTCATGCAA
AAATTAAATGTCTTTTTTCAGCATACTGACTCCAGGTGTAGTTACATCTCAGTGCTGTCT
TGAGTATATATTTTATCTCTTATACCTGTATCTCCCAACTAGAAACAGCTCCAGTGTTTT
TAAGAGAATGTTTCTTAAAACCAATAGGAAACTTAAGCGAGGTTTCATGACACAACCTTT
CATGTCGTGAAAGGCAGAGGGTGACTGTGTGTGATGTGCAGAGTCCTTGGACAGGAGTCG
GGGGCTCCTCTGTCCCACTGCTGCTTCTTGAGTGGGTGGAGTGGTGCTTAGAGGATCTCC
GAGAGGTCCCCGCAGCTCTAGGGAGATCTGATTTTGTGTTTTTTGTTTAAGTACTTCACA
CAGAAGCCTAGGTAGATTTAAAATGGGGTGCTCAGGGACTGGGGAACAAGACGGGGTGGG
GTGGGGAGATGGGCATTTGGAGAGTCTCATGTAGCTGGAGACGTTAAGAGCTGAGCACAC
CACAGGAAAGGAGGGAGGATGCTGTGTGAGAGCCATGCTGTCAGGAGCAAGCTTGCTGCT
CCTGTGCTGCCCTGGCCCTGGCCTTGCTTGCCCATGGTGTGTGTGTCCAGAGGTGTGTGT
GAGGCTGCCAGAACAAGTGCTGGGTCTGTCACAGAGAAGTTTAAAAAAGAAAACTAAGAT
TATAAATTAGCATCTAGTTCCAAAACCAAAAAAAGTGCCTGTGGATGTATATAAAATTAA
GATGATAAGAAAGTGCTCCTGAGAAGGCTCTTGCCAGAAGCCTGATGTGAGTGTGTGGCA
CCTGTGATGGCAGGGCTGTGAGCTGGGCTTCTGTCCTCCTCTGTGTCCCGGCATGGAAGC
CAGTATAAGCATTTCCAAATGAGGGAAAAGTCCTTGGCTCGTTTGATCCAGTTGAGTTGA
AAGGGTTGCCTTGGCAGCAGAGGCTCCTCTGATGGCTGACATCAGTCACTGCGTCTGGGC
CTGAGACGTGCATGGAGGGCTGTAAAGCCACGGATTCCCCTCGCTGGAGAGGCTCCTGTC
TGATAGCGGTAGATGAAAAATAAGGTCGTTATGACTTTGGCAACTTGCTTCATTTCTTTT
TCATTTGACTTACAACACACTTCTCTAACATCTAGCCCTTTTAAATTTTTAATTAATTTC
AAAGCTTCCTCTGGCCAGGTAGACTTTTGTATACAGACCAGGTGAGAGCCCTTTTGCCTT
AGTGTGAAAATGTAACATTTTATGCTTTTAAAATCAATAGATTCATCACCTTAGTTTTTT
AAAAAAAATCTATAAATAGGGTAATTGCTGAGGTGTGCGGTTTATCTTTGAGATGATAAA
GCTAAATTATAGTCTTTTGCCAGAGAAACTGAGGTAACTGTCATTAGAAAAGGTTTCTTA
AAATACTCACAAAGCTGTTATTGGCTTCTTAACTTCTAAAATTTGGGGGGTCTTGCATTT
ATTTATTATTTATTTATTTATTTATTTAGAGACAGAGTCTCACCCTGTTGGCCAGGCTGG
AGTGCAGTAAGTGGCACAATCTCGGCTCACTGCAACCTCCGCCTCCTTGGTTCCAGCAAT
TCTTCTGCCTCAGCCTCCCGAGTAGCTGGGACTACAAGCGGCTGCCACCACACCTGGCTA
TTTTTTTTTGTATTTTTAGTAGAGACAGGGTTTCGCCATATTGGCCAGGCTGGTCTTGAA
CTCCTGACCTCGTGATCCACCCGCCTCACCCTCCCAAAATGCTGGGATTACAGGCGTAAG
CCACTGCACCTGGCGGGGTCTTGCTTATTTTAAAAGAAATATTCTGATTCATATTTTAGG
ACTTTTTGTCAACGAAATTGGTTTTGATCCCTTTGGGTACCATTTTTATTGTTTTATGTA
GAATGTTAGAAATTACCACTAATTTACCTGGCAGTGATGTCAAATTGACTGTAATTAGCA
GGTAGAAAATTATTTGTATTATATTCATCTGATTCCTATACTGGATGAGCAAGGAGCATG
CTTCCTTTGGGACATTCTTACAGCAGGGTGTCTCTCCAACAGCCCGACAGGCCTCATCTT
TTTGGTTGGATACCTTTGAACTCCATGGTTACGTGTTAGGTCCACATTTGTGTTTTTTTC
TAGCCTACCTATAGTTGTTGGCCTTTTTGCATATAACTCTCGGGTAATATTTTGAAGCAT
GCTGACCATCCAGGCATATAGTATTTTCAAGAAATGACTGAGGTAGGGGTGGGGGTCCTG
GTCCGGCTGATGGGGGTTTGCTCAGCACTGTGCCAGTGGAAGCAGGTGTATTGTGGGCAG
TTTTGTCATTGTCCTCAAGTCCTTCGCAGACAGTGCACAGCCTGCTGTCTGCAGTCGGCC
AGACCAGGCTCCTCCCCAGCACACTCCCTGTGGGATGGCCGCTGCTCAGGACACAGTGGG
ACAAAGTTGGGTTGATAGGATATTTTAGATTCATTTTACCTTTGACAAGGGCAGGCCTTG
AATTGGGAGCAGCAGCCACCTGGCCTCACTCTGGCCACAGGTGACACTTGGTCCTTGCTG
CCACCTGCTTGGGGCTATGTGGCTACGGCTACACAAAAGCCTGTGCAGGTTAGAAGACGA
CTGTGGTGTGCAGTGGTGCTCTGGGAGTGGAGACTTCCTCTGTTCTCAGAGACTCACCCC
CAGCCCTGACCCTAGAATTTAGGGATAGCCAGGAAGTTTCTAGTTTGTGTAACCTAGAAG
GGTCACTTTAATAAAAATTGTTATGAACTATAGTATTTTAGATGATGAGTGACTTATTTT
AATTCCACTTTAACATTTTACTGTGCTGTTAACTTGGAAGACCTGTTTGAAATTAGTCTT
GATTTCACACTCATTTAATCTGCTGAGCACAGGGCTGTTGTCATTTGTAAACGCAAACAC
TGTGGAGGTACTTCTCGCCATCAGCTTCCTTCTTTACAAAACCATCATTTCAACATGAAA
ATTATGTCAGTTTATAGAAATATTTATTGTTCAAGGTCTGTAATTGTATTTCAAAAACGA
TGTCGTATTCAAGTTGTGAAGGGATTTGTTTTGTCAAAAAATTAAAAACTCAATGTGTAT
GACGCCACTCTGAAGAGTAGGTGAGCGCTTTGCAGTCACAGAAGGTGGCATCTGACTGCG
GCTCATACAGGTCACCCTGAAGGGCCACGTGCTTTTAGCAGTTGGCTGGAATGTGTTCAC
TAGGTTCCGTTATGTTTGGTAATATCATCTTGAAAAGTCCCTGTAATAGATCAAGGAGAC
TGCATTCCCTGCCCTGAAGGAATGTATTTCTAAGGCAAATAGGCAACTTGGTACTATCTT
ATTCTGAGTAGAGAGTGGAGAAAGTATTTTCAGACTGAAGAAAACTTTGAAAAGTCAGGA
GCTAAGCTGCTCGGAGCTCAGTGCCGCAGCATGGCTGTGGTGGACGCGGGAAACAACGGG
AAAGTTCTTGACAGAGTCTGTGTCCGCTCAGTCCCTGCACTTTTCCTTTCCAAATGCATC
TCGTTGGATATGGAATAGATCGTAGATGTTGTAGACTGAGATTTGGGACTATGTTGGGAC
CGTACAGGTGAATGTGCCACCTCCACAAATGGCTTCTCCGAGTGAGTCACGTCACCTGGT
GCGTGGAGGTGGAGCCTGCGGCTGGAGTAAGGCTTGCTGTGGGACGCCCTCGTACTTTGC
TCTCCTTGCGGGTGGTTGCCGAGCCGAGAGCATTGGATCCTCCCCGACTGTGGCTAGTTG
TCTGTCCGGTGGCTGGGAGGGGGTGTGGTGGGAAAAAGTCGGAATCTCTGCAATCTGTGT
CATGGACTGTACTATTGTAAGGTCTATATTCTGTATGTGGGTCCCAGACCCTGATCAGGA
AATGAGCCTCATGTGTGTCGTTAACATTTATATATTTCCATTCAAAATATGTATTCAGTG
TTTATTTCCTCAAAACAGACTTTGTTAATGTAGGAAATCTCTCCAAGTGGAAACGTGCTA
ACTTTTTCTGTAAATCTGAAATAAAAGGTGCTGTTCCTTCCTCTGA

Protein Sequence

>7468 : length: 1365
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEG
VMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMV
SADPLLHSYTKLKGQKKSARQYHVQFFGDAPERAWIFEKSLVAFEGEGQFEKLCQESAKQ
APTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGK
STPQKTAEADPRRGVGSPPGRKKTTVSMPRSRKGDAASQFLVFCQKHRDEVVAEHPDASG
EEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKR
NRASTAASSALGFSKSSSPSASLTENEVSDSPGDEPSESPYESADETQTEVSVSSKKSER
GVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKG
KMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAHFTARKGKRHHAHVNVSWCFVCSKG
GSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKN
ALQEAEARFREIKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTADISEIPKCNCKP
TDENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTKRQYPETKIIKTDGKGWGLVAK
RDIRKGEFVNEYVGELIDEEECMARIKHAHENDITHFYMLTIDKDRIIDAGPKGNYSRFM
NHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSG
FLGDRPKTSTTLSSEEKGKKTKKKTRRRRAKGEGKRQSEDECFRCGDGGQLVLCDRKFCT
KAYHLSCLGLGKRPFGKWECPWHHCDVCGKPSTSFCHLCPNSFCKEHQDGTAFSCTPDGR
SYCCEHDLGAASVRSTKTEKPPPEPGKPKGKRRRRRGWRRVTEGK