ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7410

Name

VAV2

Synonym

VAV-2;vav 2 guanine nucleotide exchange factor;VAV2;vav 2 guanine nucleotide exchange factor

Definition

guanine nucleotide exchange factor VAV2|vav 2 oncogene

Position

9q34.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

B cell receptor signaling pathway;KEGG PATHWAY;hsa04662

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

Regulation of RAC1 activity;PID Curated;200165

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Signaling by Rho GTPases;Reactome;REACT:11044

Pathway

EPO signaling pathway;PID Curated;200157

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

T cell activation;PANTHER;P00053

Pathway

Nectin adhesion pathway;PID Curated;200053

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

Regulation of CDC42 activity;PID Curated;200059

Pathway

EPHA2 forward signaling;PID Curated;200185

Pathway

B cell activation;PANTHER;P00010

Pathway

phosphoinositides and their downstream targets;PID BioCarta;100059

Pathway

Signal transduction by L1;PID Reactome;500100

Pathway

E-cadherin signaling in the nascent adherens junction;PID Curated;200105

Pathway

EPHA forward signaling;PID Curated;200121

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Regulation of RhoA activity;PID Curated;200050

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Disease

Multiple sclerosis;NHGRI

External Links

Links to cell senescence gene database

7410

Links to epithelial mesenchymal transition gene database

7410

Links to ovarian cancer gene database

7410

Links to endometrial cancer gene database

7410

Links to iHOP

7410

Sequence Information

Nucleotide Sequence

>7410 : length: 4925
CCGGCCCTGAGCCCCGCGCGCGCGCGGGCGGGATGCCCCGCGGCCGCTGCACTTTGGCTC
GAGCACTGCCCTGAGCCGGTCGGGCCCGCGGGCGCCATGGAGCAGTGGCGGCAGTGCGGC
CGCTGGCTCATCGATTGCAAGGTCCTGCCGCCCAACCACCGGGTGGTGTGGCCCTCGGCC
GTGGTCTTCGACCTGGCGCAGGCGCTGCGCGACGGGGTCCTTCTGTGCCAGCTGCTGCAC
AACCTCTCCCCCGGCTCCATCGACCTCAAGGACATCAACTTCCGGCCGCAGATGTCCCAG
TTTCTGTGTTTGAAGAACATACGCACCTTCCTGAAAGTCTGCCACGATAAATTTGGATTA
AGGAACAGCGAGCTGTTTGACCCCTTTGACCTCTTCGATGTGCGAGACTTTGGAAAGGTC
ATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCT
TTTCCCTCAGAGGAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTG
GCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTCCCGTGTGAGGATGGAGGG
GACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGAAAATGGGCATG
ACTGAAGATGACAAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTAC
TACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCCCTGCGGCTGGTGCTGAGC
CCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCACAGC
TTCCTGAGGGCCATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTC
CTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGCAGCCACATGGAGCACGCC
CAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAG
TGCACACTGAAGGTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATG
CAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTGAGCCATTCTGCGGAACGG
CCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTACATC
AATGAAGTTAAACGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATA
GAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAGATTGACGGGGAACTGAAA
GTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTG
GTCATCGTCTGCAAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTG
TTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTCAAGAAGCAAGCAGGCTTT
CCTCTCCCGTCCCACCCTGCGGTGCTTGGAGGAGGGCTGTGGTGGTCCTACGGCTTCTAC
CTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAG
AGGAAGTGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAAT
GCCAACCACCACAGTTTCCAGATGTACACGTTTGACAAGACCACCAACTGCAAAGCCTGC
AAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGG
GCACACAAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTG
GACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTGGCCATGCAGAATTACCATGGCAAC
CCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTG
AGGGGCGACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGG
TATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTGGATGGAAGGCCGCCCATCAGCCGG
CCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGG
CAGCAGACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGG
CCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAGTTCAATGATGAGGTGAAGCACATC
AAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTC
CTGGAGTTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGAC
ACCACACTCAAGTACCCCTACAAGTCCCGGGAACGTTCGGCCTCCAGGGCCTCCAGCCGG
TCCCCAGCTTCCTGTGCTTCCTACAACTTTTCTTTTCTCAGTCCTCAGGGCCTCAGCTTT
GCTTCTCAGGGCCCCTCCGCTCCCTTCTGGTCAGTGTTCACGCCCCGCGTCATCGGCACA
GCTGTGGCCAGGTATAACTTTGCCGCCCGAGATATGAGGGAGCTTTCGCTGCGGGAGGGT
GACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACC
AACGGACGGATTGGCTGGTTTCCTTCAACGTACGTAGAAGAGGAGGGCATCCAGTGACGG
CAGGAACGTGGACAAGACTCGCAGATTTTCTTGGGAGAGTCACTCCAGCCCTGAAGTCTG
TCTCTAGCTCCTCTGTGACTCAGAGGGGAAATACCAACCTCCCAGTCTTCCACTGCCCAC
AGGGATAGGGAGGGTGTTGAGAATCCTAAACTCGAACCGTTTCACTGTCAGCCTGCCCTC
GGCGACCCATCACTGGGTATGCTATTGTACATAGAGGAAACCTGGGCTAGCCCCACCCAG
AGCGCAGAGGAGGGGGCACCGACAGCGCTGCGAGCCAGGCTCTGGGTAGTGGCTGAGGCC
AGAGGCCCATCGCCTGCCCCTGTCCAACTGAGATGGCCTTCAGGAGCCTAGGTTTGAACA
GCAGATGCTGTCCCAGGAAGGGCTAGGGACATCGGAGGGGACCTGCCCCCACACCCTCTG
CTCAGCCCCTGGACTCAGCCTTGCCTGTCTTTTCCTGCTGCTCCCAGGGGGAGGTGTCAG
ACCTCGGGAGGCAGACGGGACCAGAGCCAGGCTGTTCACTGTGGGCCCACTTGCCCCACT
GTGCTAGGGCGCGGGAGGAGAGAGCACTGTGGTCGCCCTCTGCAGCCACTCTGGCTCCCA
AGACTTCCCTGACTCCCCCACTCCCCTCCTTGCCAGGGGCACACCCGGACCCCACACGGC
AGGCCCCTCTCTTGGGAGGGGCCTTTGGAATGATGAAATTCCAACCCTGCTGCCCGGTCA
GCGGTACCGTTTCCTGCCCTCTCTCTGAGAGGCCCTTTCTGGAGTCCTGGGAAGGTGTCT
GCCTGGCCGCGCTGCCAGATCAGTACATCTTTTGTAAAAACCCTGAAATGGGCAGGGAAG
AAAACAGGGATTTCCCCTCTCTAGATCCCTGCCAGGTCCCTCTCCAGGAGGCCCCTCTGC
TCTCCTGAAGGGTGGTCCCTGAGGGTCTGCCCAGCCTTGGCACGAGAGGTTGGTTCCAGC
CCCTGGCAGGGCTTCCTTCCAAGGGCCCCTGCAGCCTACAAACTGGGCCTCGGGCGACTC
AAAATAAGTGCTCTTGGGGGTGGCTCTACCCCATTACCTCCCCCAGCCACAACTCCTGGC
CTTCGACTTCTGGCTGGGTTAGCCAGACCCTGGTTTCTCTACCCTGATGTTGCATGAGAC
CTGGTAACAGTGTCTCCCTCCCAGCTCCTTGCCAAAGCCTCTGTTGAGACCTGGGCTTCT
TGTAGCCCCTTCTCCCTCTGGCCAGCTGCACAGCCTGTGGGAGGTGCCCGGCCCAGGCTG
GGTGTGGGGGAAGCTGGTCCCTGCTGTGGGTGGCGCTGGGGACCTAGGGGCTCCTTCTGA
GGTTGGCCTTGTGGCCTCTGGGCTGTATGCCTCTGGGGTGTAGGGAAGAGGCGGGAGGAG
TCATGGGGATGGGGAGCGGCAGGGGGAGAGAGGGGCCCTCGACAAAGGCTTGGGAAATGA
GGGGAGGTGGAGGCAGGGCAGGGGAAGCGAAGAGTCAGCCTTGGAGAGAGCACCCTGGGG
CCTCCGTGTCGGGGTACACCCAGCACTTTGCGACCTGCGGCCCAGCAGGCGCGGAGGATG
GCGGGGAGGAAGCCAGCAGCCCCTGTGTTTACTGTCGTCAGAAAGGTCTTGTGTTTTGGT
TTTGGGGTTTTTGTTTTGTTTGTGTTTTGTTTGGCTTGTTTGTTTTTTAAGGGGAAAAAA
GTTTGTAATTATTTCATCCAAATCTCCCGTTATATATCTGTGAATAATAAGAGATTTTAT
AATAGCAAGAAAATGATGTATATTTTAGTTTGTTGACAAATAAGTCATCATGATCACGAA
GGACACTGAGAAAAAATAATTTAGAACCCTGGTTTTTGTGAATTTTTTTGTTTTGTGTTT
CTTTGTTTTGAGATTTGTGTTTGGTTTGGTTTTTGCACTGCACTAAGGCAGGAGGGTTGG
AGGGCTGGGTGCAGCCTGGGAGTCCGATGGTTTTCAGCAGGAGACGGGGTGTCCCCTGCA
GGGGGCTAAACTGCAGGGGCCTGAGATTAGCTGTGAACATGTGGGAGCCCGATGCATGTG
GGTCAGGGATCTGGGGGCCCCCCCAGCTGGCGGGAACCCCAAATGGACACAAACTGTACA
TTTGCCAATGGGTTTTTTTCAGACCATGGTTTTTACTTGCAAATAAACCTGAGTTCTTTT
CTGCA

Protein Sequence

>7410 : length: 886
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
AQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEV
QQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLE
DLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASRE
DFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSAERPERQQLKEALEA
MQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDR
YLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKQAGFPLPSHPAVLGGG
LWWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFD
KTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMV
AMQNYHGNPAPPGKPVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPV
DGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIK
FNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRER
SASRASSRSPASCASYNFSFLSPQGLSFASQGPSAPFWSVFTPRVIGTAVARYNFAARDM
RELSLREGDVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ