ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7409

Name

VAV1

Synonym

VAV;vav 1 guanine nucleotide exchange factor;VAV1;vav 1 guanine nucleotide exchange factor

Definition

proto-oncogene vav|vav 1 oncogene

Position

19p13.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

B cell receptor signaling pathway;KEGG PATHWAY;hsa04662

Pathway

ras-independent pathway in nk cell-mediated cytotoxicity;PID BioCarta;100095

Pathway

pkc-catalyzed phosphorylation of inhibitory phosphoprotein of myosin phosphatase;PID BioCarta;100100

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

rac1 cell motility signaling pathway;PID BioCarta;100056

Pathway

Fc-epsilon receptor I signaling in mast cells;PID Curated;200003

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

Regulation of RAC1 activity;PID Curated;200165

Pathway

Class I PI3K signaling events;PID Curated;200098

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Signaling by Rho GTPases;Reactome;REACT:11044

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

rho cell motility signaling pathway;PID BioCarta;100041

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

T cell activation;PANTHER;P00053

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

CD28 dependent Vav1 pathway;PID Reactome;500486

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

TCR signaling in naive CD4+ T cells;PID Curated;200022

Pathway

B cell activation;PANTHER;P00010

Pathway

bcr signaling pathway;PID BioCarta;100227

Pathway

t cell receptor signaling pathway;PID BioCarta;100022

Pathway

fc epsilon receptor i signaling in mast cells;PID BioCarta;100165

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Regulation of RhoA activity;PID Curated;200050

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

TCR signaling in naive CD8+ T cells;PID Curated;200062

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

Signaling events mediated by Stem cell factor receptor (c-Kit);PID Curated;200156

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

External Links

Links to cell senescence gene database

7409

Links to epithelial mesenchymal transition gene database

7409

Links to ovarian cancer gene database

7409

Links to endometrial cancer gene database

7409

Links to iHOP

7409

Sequence Information

Nucleotide Sequence

>7409 : length: 2944
CTCTCAGGGCGACAGTTACAGGCAAAGAAGAGGAAGTGGTAGCACTAGCTGTCGCTCCAC
AGGCGAGCAGGGCAGGCGTGCGGGCGGGTGGGTGGTGGAGGCTGCGAGGGTGCACGGCCG
GCCCTGGGCAGGCGGTAGCCATGGAGCTGTGGCGCCAATGCACCCACTGGCTCATCCAGT
GCCGGGTGCTGCCGCCCAGCCACCGCGTGACCTGGGATGGGGCTCAGGTGTGTGAACTGG
CCCAGGCCCTCCGGGATGGTGTCCTTCTGTGTCAGCTGCTTAACAACCTGCTACCCCATG
CCATCAACCTGCGTGAGGTCAACCTGCGCCCCCAGATGTCCCAGTTCCTGTGCCTTAAGA
ACATTAGAACCTTCCTGTCCACCTGCTGTGAGAAGTTCGGCCTCAAGCGGAGCGAGCTCT
TCGAAGCCTTTGACCTCTTCGATGTGCAGGATTTTGGCAAGGTCATCTACACCCTGTCTG
CTCTGTCCTGGACCCCGATCGCCCAGAACAGGGGGATCATGCCCTTCCCCACCGAGGAGG
AGAGTGTAGGTGATGAAGACATCTACAGTGGCCTGTCCGACCAGATCGACGACACGGTGG
AGGAGGATGAGGACCTGTATGACTGCGTGGAGAATGAGGAGGCGGAAGGCGACGAGATCT
ATGAGGACCTCATGCGCTCGGAGCCCGTGTCCATGCCGCCCAAGATGACAGAGTATGACA
AGCGCTGCTGCTGCCTGCGGGAGATCCAGCAGACGGAGGAGAAGTACACTGACACGCTGG
GCTCCATCCAGCAGCATTTCTTGAAGCCCCTGCAACGGTTCCTGAAACCTCAAGACATTG
AGATCATCTTTATCAACATTGAGGACCTGCTTCGTGTTCATACTCACTTCCTAAAGGAGA
TGAAGGAAGCCCTGGGCACCCCTGGCGCAGCCAATCTCTACCAGGTCTTCATCAAATACA
AGGAGAGGTTCCTCGTCTATGGCCGCTACTGCAGCCAGGTGGAGTCAGCCAGCAAACACC
TGGACCGTGTGGCCGCAGCCCGGGAGGACGTGCAGATGAAGCTGGAGGAATGTTCTCAGA
GAGCCAACAACGGGAGGTTCACCCTGCGGGACCTGCTGATGGTGCCTATGCAGCGAGTTC
TCAAATATCACCTCCTTCTCCAGGAGCTGGTGAAACACACGCAGGAGGCGATGGAGAAGG
AGAACCTGCGGCTGGCCCTGGATGCCATGAGGGACCTGGCTCAGTGCGTGAACGAGGTCA
AGCGAGACAACGAGACACTGCGACAGATCACCAATTTCCAGCTGTCCATTGAGAACCTGG
ACCAGTCTCTGGCTCACTATGGCCGGCCCAAGATCGACGGGGAACTCAAGATCACCTCGG
TGGAACGGCGCTCCAAGATGGACAGGTATGCCTTCCTGCTCGACAAAGCTCTACTCATCT
GTAAGCGCAGGGGAGACTCCTATGACCTCAAGGACTTTGTAAACCTGCACAGCTTCCAGG
TTCGGGATGACTCTTCAGGAGACCGAGACAACAAGAAGTGGAGCCACATGTTCCTCCTGA
TCGAGGACCAAGGTGCCCAGGGCTATGAGCTGTTCTTCAAGACAAGAGAATTGAAGAAGA
AGTGGATGGAGCAGTTTGAGATGGCCATCTCCAACATCTATCCGGAGAATGCCACCGCCA
ACGGGCATGACTTCCAGATGTTCTCCTTTGAGGAGACCACATCCTGCAAGGCCTGTCAGA
TGCTGCTTAGAGGTACCTTCTATCAGGGCTACCGCTGCCATCGGTGCCGGGCATCTGCAC
ACAAGGAGTGTCTGGGGAGGGTCCCTCCATGTGGCCGACATGGGCAAGATTTCCCAGGAA
CTATGAAGAAGGACAAACTACATCGCAGGGCTCAGGACAAAAAGAGGAATGAGCTGGGTC
TGCCCAAGATGGAGGTGTTTCAGGAATACTACGGGCTTCCTCCACCCCCTGGAGCCATTG
GACCCTTTCTACGGCTCAACCCTGGAGACATTGTGGAGCTCACGAAGGCTGAGGCTGAAC
AGAACTGGTGGGAGGGCAGAAATACATCTACTAATGAAATTGGCTGGTTTCCTTGTAACA
GGGTGAAGCCCTATGTCCATGGCCCTCCTCAGGACCTGTCTGTTCATCTCTGGTACGCAG
GCCCCATGGAGCGGGCAGGGGCAGAGAGCATCCTGGCCAACCGCTCGGACGGGACTTTCT
TGGTGCGGCAGAGGGTGAAGGATGCAGCAGAATTTGCCATCAGCATTAAATATAACGTCG
AGGTCAAGCACATTAAAATCATGACAGCAGAAGGACTGTACCGGATCACAGAGAAAAAGG
CTTTCCGGGGGCTTACGGAGCTGGTGGAGTTTTACCAGCAGAACTCTCTAAAGGATTGCT
TCAAGTCTCTGGACACCACCTTGCAGTTCCCCTTCAAGGAGCCTGAAAAGAGAACCATCA
GCAGGCCAGCAGTGGGAAGCACAAAGTATTTTGGCACAGCCAAAGCCCGCTATGACTTCT
GCGCCCGAGACCGATCAGAGCTGTCGCTCAAGGAGGGTGACATCATCAAGATCCTTAACA
AGAAGGGACAGCAAGGCTGGTGGCGAGGGGAGATCTATGGCCGGGTTGGCTGGTTCCCTG
CCAACTACGTGGAGGAAGATTATTCTGAATACTGCTGAGCCCTGGTGCCTTGGCAGAGAG
ACGAGAAACTCCAGGCTCTGAGCCCGGCGTGGGCAGGCAGCGGAGCCAGGGGCTGTGACA
GCTCCCGGCGGGTGGAGACTTTGGGATGGACTGGAGGAGGCCAGCGTCCAGCTGGCGGTG
CTCCCGGGATGTGCCCTGACATGGTTAATTTATAACACCCCGATTTCCTCTTGGGTCCCC
TCAAGCAGACGGGGCTCAAGGGGGTTACATTTAATAAAAGGATGAAGATGGATAGAAAAA
AAAA

Protein Sequence

>7409 : length: 845
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS
EPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINI
EDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVYGRYCSQVESASKHLDRVAAA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEAMEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVF
QEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVH
GPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKI
MTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGS
TKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEED
YSEYC