ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7375

Name

USP4

Synonym

UNP|Unph;ubiquitin specific peptidase 4 (proto-oncogene);USP4;ubiquitin specific peptidase 4 (proto-oncogene)

Definition

deubiquitinating enzyme 4|ubiquitin carboxyl-terminal esterase 4|ubiquitin carboxyl-terminal hydrolase 4|ubiquitin specific protease 4 (proto-oncogene)|ubiquitin thioesterase 4|ubiquitin thiolesterase 4|ubiquitin-specific processing protease 4|ubiquitous

Position

3p21.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

7375

Links to epithelial mesenchymal transition gene database

7375

Links to ovarian cancer gene database

7375

Links to endometrial cancer gene database

7375

Links to iHOP

7375

Sequence Information

Nucleotide Sequence

>7375 : length: 4120
GTGCGTGCGTGGGCGCGGTCTATAGCACGCCGCGCGCGGGGCGGATGTCCGGGCCGGCTG
GGCCGGGGCCGCGGAGGAGATGGCGGAAGGTGGAGGCTGCCGTGAGCGACCGGATGCGGA
GACTCAGAAGTCCGAGCTTGGACCCTTAATGAGGACCACACTCCAACGCGGGGCGCAGTG
GTATCTTATTGACAGCCGGTGGTTCAAGCAGTGGAAGAAGTATGTGGGCTTTGACAGCTG
GGACATGTACAATGTGGGTGAACATAACCTATTTCCTGGCCCAATAGACAACTCTGGGCT
ATTTTCAGATCCTGAGAGTCAGACCTTGAAAGAACACTTAATTGATGAATTGGACTATGT
ATTGGTCCCTACCGAGGCGTGGAATAAACTACTAAACTGGTACGGCTGTGTAGAAGGCCA
GCAACCCATCGTCAGAAAAGTTGTGGAGCATGGCCTGTTTGTCAAGCACTGCAAAGTCGA
GGTGTATTTGCTGGAACTGAAGCTCTGTGAGAACAGTGACCCCACCAATGTGCTGAGTTG
CCATTTCAGCAAGGCAGACACCATTGCAACCATCGAGAAAGAGATGCGGAAGCTATTCAA
CATCCCTGCGGAGCGTGAAACACGGCTCTGGAACAAATACATGAGCAACACCTACGAGCA
GTTGAGCAAGCTAGACAACACTGTCCAGGATGCTGGGCTATACCAGGGTCAGGTGCTAGT
AATTGAGCCTCAAAATGAAGATGGCACATGGCCCAGGCAGACCTTGCAGTCAAAATCAAG
CACTGCGCCTAGCAGAAATTTTACTACCTCTCCAAAATCATCAGCAAGTCCCTATTCCTC
AGTGTCTGCCTCTCTCATTGCAAATGGTGATAGCACTAGCACCTGTGGGATGCACAGTTC
CGGTGTCAGCAGGGGTGGATCTGGCTTTTCTGCTTCGTATAATTGTCAGGAGCCACCATC
CTCTCATATACAACCTGGGCTCTGTGGACTTGGAAACCTGGGAAACACCTGCTTCATGAA
CTCCGCTTTGCAGTGTTTGAGCAACACTGCACCACTGACTGACTACTTTCTCAAAGATGA
GTATGAAGCCGAAATCAACAGAGACAACCCTCTGGGGATGAAAGGGGAAATTGCAGAAGC
CTATGCTGAACTCATTAAGCAGATGTGGTCTGGAAGGGACGCCCATGTGGCACCTCGCAT
GTTCAAAACTCAAGTAGGACGTTTTGCTCCTCAATTTTCTGGCTACCAGCAACAAGATTC
TCAGGAGCTGCTGGCCTTTCTTCTAGATGGATTGCATGAAGATCTGAACCGGGTAAAGAA
AAAGCCCTACTTGGAGCTGAAGGATGCCAATGGGCGGCCAGATGCGGTGGTGGCAAAGGA
AGCCTGGGAGAATCACAGGTTGAGGAATGATTCTGTGATTGTGGATACTTTCCATGGCCT
CTTCAAATCTACTTTGGTTTGCCCAGAATGTGCTAAGGTTTCTGTGACCTTTGACCCATT
TTGCTATCTAACGCTGCCACTGCCCTTGAAGAAAGATCGAGTTATGGAGGTTTTCCTGGT
TCCTGCTGACCCTCACTGCAGACCTACTCAGTACCGTGTGACTGTGCCGCTGATGGGGGC
TGTGTCCGACCTGTGCGAGGCTCTCTCCAGGCTGTCTGGCATTGCTGCAGAAAATATGGT
GGTCGCAGATGTGTATAATCACCGATTCCACAAAATTTTCCAAATGGATGAAGGTTTAAA
CCACATCATGCCTCGGGATGACATTTTCGTGTACGAGGTCTGCAGCACTTCCGTGGATGG
CTCGGAATGTGTCACGCTTCCAGTCTACTTCAGGGAGAGGAAGTCCAGGCCATCAAGCAC
TTCCTCCGCATCAGCGCTATATGGGCAGCCACTATTGCTTTCTGTCCCCAAGCACAAGTT
AACCCTTGAGTCTTTGTACCAGGCTGTTTGTGATCGTATCAGCCGCTATGTGAAACAGCC
TTTACCTGATGAGTTTGGCAGCTCACCCTTGGAGCCAGGGGCCTGCAATGGCTCCAGGAA
CAGCTGTGAAGGAGAAGATGAGGAAGAAATGGAGCATCAGGAAGAAGGCAAAGAGCAGCT
TTCAGAAACAGAAGGCAGTGGGGAAGATGAGCCAGGAAATGACCCCAGTGAGACCACCCA
AAAGAAGATCAAAGGCCAGCCCTGCCCAAAAAGGCTTTTTACCTTCAGTCTTGTGAACTC
CTATGGAACAGCTGACATAAATTCACTTGCAGCTGATGGAAAACTACTTAAACTCAACTC
TCGATCTACACTGGCCATGGATTGGGACAGTGAAACTCGGAGACTTTACTATGATGAGCA
AGAATCTGAGGCCTACGAGAAGCATGTGAGCATGTTGCAGCCTCAGAAGAAGAAGAAGAC
CACAGTGGCCCTGAGAGACTGCATCGAGCTCTTCACCACCATGGAGACCCTTGGGGAGCA
TGACCCCTGGTACTGTCCCAACTGTAAGAAGCATCAACAGGCCACAAAAAAGTTTGACCT
ATGGTCCTTGCCCAAGATCCTGGTGGTCCACCTCAAACGTTTCTCCTACAACAGATACTG
GAGGGATAAGCTCGACACAGTCGTAGAATTCCCAATCAGAGGGCTGAACATGTCCGAGTT
TGTCTGTAACCTGTCAGCAAGGCCTTATGTGTACGACCTCATTGCCGTGTCCAATCATTA
TGGAGCCATGGGGGTTGGCCACTACACTGCATATGCGAAGAACAAACTGAATGGTAAATG
GTATTACTTTGATGATAGCAACGTGTCCCTGGCCTCTGAGGATCAGATAGTGACTAAAGC
AGCTTATGTGCTATTTTACCAACGTCGAGATGATGAATTTTATAAGACACCTTCACTTAG
CAGTTCTGGTTCCTCTGATGGAGGGACACGACCAAGCAGCTCTCAGCAGGGCTTTGGGGA
TGATGAGGCTTGCAGCATGGACACCAACTAATGCTGACTCCACGATCCTGCCACCCTGTA
GCGCCAGTGTAATCCCCCAGGAGAACATCTTTGACACTCTGCAGACTGCTAGTGTTCTGT
CTAAAAACCAGACAAGGAAATACCCTTCTTTTATGAGCAGAAGGAAACAAAAAAAAAAAA
AGAAGACCGTTTACCTAGAAGAAGCTATGTCAAGAGGCTGAATTATTTTTATTTTTAAAC
AGGTGGTGAGAAATTTCTGTGAAACCTGTGAAGCTGAAAAGGGGGTGGGATGGGGGTACT
CAATGGAGTATGTCTGATGGATCCCGAAGAATGGAGAGGAACACAGGCGCTGAGTATGGA
GCAGCCTGGAGACCCACCCCACCTGCAGGGCTGCCCTGAGCGCCTGGATTTCTGGTTCTG
ATGCCAATACTAGTCACCCCAAGTAGTCTGCTCACAGTAACCCAAACCTCAAGTAAACTC
CCCTTTCCCTCGCTATGTGCACTGATATGGGTTTATAATTTTCTGAAAGTTACCCACTGA
AGCCCATTTCTCCGTTGAGTCATCTTGTAATTTCCAGCTTTCTCCCCGCTAAGGAAGATA
TCTAGTGTTGGGGATCCTGGCCCCTCAACCTCCTGTGGAACCCAGCAGTTCTGTTATATC
CCCTGCTACCCTAGATGAATTAAGACGGTTAAATACTGTGTGGAACTTTTATTAGATAAC
ACACTTTTTATTAGATAACGCTTAAAGGAAGTCAGTACATAAAACTGCCCGGTGCTGTGT
CCCGTCTAGTTGTTTCCATGTTGGCTTGAGAACAGAAATCTTTGTGGGAGTTAGCCGGGA
AAGGGCTCCAGTTCATGGCGATTTAGGGTAGTAATACATTTTGGTGTTACCCAGATGCTT
TCTAGAACGGGTTCTTTCCTCATCCCTGCCAAGACTCTTCCCGGGGCCCCCATTCGAAAG
CCCCGTCCCCACTCCCACCGCGGGGCCAGCCGCTGCGTGTGGGCAAGGCCTTAAGGAACC
GGACGTATGGGTCCGGGATTTTTTGTCTGACCTTCAACCTAATCCGTGGGGGTTTGGGGC
CTGCGCGGGGCACGCGCATGCGATGACCGTTGGATGGGTCGGCGTCACTGCGCTGCGGGT
GAGGACAAGGACGTGGCTGCCGACTCGCCAAAGGGGGGGT

Protein Sequence

>7375 : length: 963
MAEGGGCRERPDAETQKSELGPLMRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVG
EHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRK
VVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERE
TRLWNKYMSNTYEQLSKLDNTVQDAGLYQGQVLVIEPQNEDGTWPRQTLQSKSSTAPSRN
FTTSPKSSASPYSSVSASLIANGDSTSTCGMHSSGVSRGGSGFSASYNCQEPPSSHIQPG
LCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIK
QMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLEL
KDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLP
LPLKKDRVMEVFLVPADPHCRPTQYRVTVPLMGAVSDLCEALSRLSGIAAENMVVADVYN
HRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASAL
YGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGED
EEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADI
NSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALRD
CIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDT
VVEFPIRGLNMSEFVCNLSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDS
NVSLASEDQIVTKAAYVLFYQRRDDEFYKTPSLSSSGSSDGGTRPSSSQQGFGDDEACSM
DTN