ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7306

Name

TYRP1

Synonym

CAS2|CATB|GP75|OCA3|TRP|TRP1|TYRP|b-PROTEIN;tyrosinase-related protein 1;TYRP1;tyrosinase-related protein 1

Definition

5,6-dihydroxyindole-2-carboxylic acid oxidase|DHICA oxidase|catalase B|glycoprotein 75|melanoma antigen gp75

Position

9p23

Gene Type

protein-coding

Pathways and Diseases

Pathway

ethanol degradation IV (peroxisomal);BioCyc;PWY66-162

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Tyrosine metabolism;KEGG PATHWAY;hsa00350

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

Metabolic pathways;KEGG PATHWAY;hsa01100

Pathway

superoxide radicals degradation;BioCyc;DETOX1-PWY

Disease

Albinism, rufous;OMIM

Disease

Uveomeningoencephalitic syndrome;FunDO

Disease

Genetic disorders;KEGG DISEASE

Disease

Blue vs green eyes;GAD

Disease

Inherited disorders of amino acid metabolism;KEGG DISEASE

Disease

Skin disease;FunDO

Disease

Albinism, brown;OMIM

Disease

Oculocutaneous albinism;KEGG DISEASE;H00168

Disease

Blue vs. green eyes;NHGRI

Disease

Glaucoma;FunDO

External Links

Links to cell senescence gene database

7306

Links to epithelial mesenchymal transition gene database

7306

Links to ovarian cancer gene database

7306

Links to endometrial cancer gene database

7306

Links to iHOP

7306

Sequence Information

Nucleotide Sequence

>7306 : length: 2876
ACAGTTCTGACGTGAGAGGACAAGAAACACAAGCAAATATAAAACATTCAATTCTAAGAG
AAGTTCATCAGAGACATCCTTCAGGATTGTGAGCTGGATTTTCCTCTACGTGCTTCAGTC
TTCTCTACACAAAGAGCTGCAAACCAGGTCTTTGTTTTGCACTCTTATTTCAAGCAGAAT
GAGTGCTCCTAAACTCCTCTCTCTGGGCTGTATCTTCTTCCCCTTGCTACTTTTTCAGCA
GGCCCGGGCTCAATTCCCAAGACAGTGTGCCACTGTTGAGGCTTTGAGAAGTGGTATGTG
TTGCCCAGACCTGTCCCCTGTGTCTGGGCCTGGGACAGACCGCTGTGGCTCATCATCAGG
GAGGGGCAGATGTGAGGCAGTGACTGCAGACTCCCGGCCCCACAGCCCTCAGTATCCCCA
TGATGGCAGAGATGATCGGGAGGTCTGGCCCTTGCGCTTCTTCAATAGGACATGTCACTG
CAACGGCAATTTCTCAGGACACAACTGTGGGACGTGCCGTCCTGGCTGGAGAGGAGCTGC
CTGTGACCAGAGGGTTCTCATAGTCAGGAGAAATCTTCTGGACTTAAGTAAAGAAGAAAA
GAACCACTTTGTCCGGGCCCTGGATATGGCAAAGCGCACAACTCACCCTTTATTTGTCAT
TGCCACCAGGAGATCAGAAGAAATACTGGGGCCAGATGGCAACACGCCACAATTTGAGAA
CATTTCCATTTATAACTACTTTGTTTGGACACACTATTACTCAGTCAAAAAGACTTTCCT
TGGGGTAGGACAGGAAAGCTTTGGTGAAGTGGATTTCTCTCATGAGGGACCAGCTTTTCT
CACATGGCACAGGTACCACCTCCTGCGTCTGGAGAAAGACATGCAGGAAATGTTGCAAGA
GCCTTCTTTCTCCCTTCCTTACTGGAATTTTGCAACGGGGAAAAATGTCTGTGATATCTG
CACGGATGACTTGATGGGATCCAGAAGCAACTTTGATTCCACTCTAATAAGCCCAAACTC
TGTCTTTTCTCAATGGCGAGTGGTCTGTGACTCCTTGGAAGATTATGATACCCTGGGAAC
ACTTTGTAACAGCACCGAGGATGGGCCAATTAGGAGAAATCCAGCTGGAAATGTGGCCAG
ACCAATGGTGCAACGTCTTCCTGAACCACAGGATGTCGCTCAGTGCTTGGAAGTTGGTTT
ATTTGACACGCCTCCTTTTTATTCCAACTCTACAAACAGTTTCCGAAACACAGTGGAAGG
TTACAGTGACCCCACGGGAAAGTATGACCCTGCTGTTCGAAGTCTTCACAATTTGGCTCA
TCTATTCCTGAATGGAACAGGGGGACAAACCCATTTGTCTCCAAATGATCCTATTTTTGT
CCTCCTGCACACCTTCACAGATGCAGTCTTTGATGAATGGCTGAGGAGATACAATGCTGA
TATATCCACATTTCCATTGGAAAATGCCCCTATTGGACATAATAGACAATACAACATGGT
GCCATTCTGGCCCCCAGTCACCAACACAGAAATGTTTGTTACTGCTCCAGACAACCTGGG
ATACACTTATGAAATTCAATGGCCAAGTCGGGAGTTTAGTGTACCTGAGATAATTGCCAT
AGCAGTAGTTGGCGCTTTGTTACTGGTTGCACTCATTTTTGGGACTGCTTCTTATCTGAT
TCGTGCCAGACGCAGTATGGATGAAGCTAACCAGCCTCTCCTCACTGATCAGTATCAATG
CTATGCTGAAGAATATGAAAAACTCCAGAATCCTAATCAGTCTGTGGTCTAACAAATGCC
CTACTCTCTTATGCATTAGTATCACAAAACCACCTGGTTGAATATAATAGATTGAGTTAT
TAACTGTATTTTCTTTCACTTTATTACCTTCTTTCTAATACAAGCATATGTTAGCATTAA
AGTTCTAGGCATACTTTTCAAAGCTGGGAAGACCCTTTCAGAATCTTTTCAATGGGTTTT
AATTTTCAGTTCTATTTAAAATGGTGAATGACACTAAACTCCATGATATTTAAGGATAGT
GTGAAGATCTTTGGCATGATTTAAAGGTTGAGTATGTGAAGATATAAGTAAGTGAACTAC
CATGCTTTGTTTACGTGTAAAGGAAAATAATGTTTGATAGTAAATGTCCACTTAAAATAC
ATGAATGGGCATTTCTAAAATGTTAAAACATAAACACATTTCCATTCATGGATATTTGTC
AACAGATTTAAAGAAAACCACAGTTATTAATTAAAGAAAATTAATTATGTGTAGTTATAA
ACCAATGAAATTTTGATTAACCTTTTCAAATTAATGTTCCAGTTTGAAGACCAATCAAAT
ATATTATTTAGTCAACATATACTATTTAGTCTCAGGTTCAAGGCTACAACAAAAATCACC
ATCTTTGTCAAACTTTGGAGAGGGAAAATCTTCACTTTCTTAAGCAACAATGGATATTGC
CTGTGTTTGCCACTGTGTTTCCCTGCCTCTCAATTCGCTGAAAAAGGAACTACCTATCCT
TACATTTCACCTACTAATGTCTCTTCTAACATCTTAGAGGTCCATGGAGAAGGCATATGG
AGAACATGTTTTATACTGCTCTATAAATAGTATTCCAATCACTGTGCTTAATTTAAATAG
CATTATCTTATCATTTATCAGCCTTTTATGTATTTTCCAAGTAAAATATTAACATATTAT
TTCATTGGTCTTCTTTTTTATCTGGTTCTATATGAATGCTATTTTTTCCCTTCTCTTCTA
ACATGAAATATATTTTCTCTTTTTGATCTTGTGCTATGAAACAATCTTCCAAAGAACTGT
ATAAGGTGGTCATAAGTGAATATTTTAATTAAAATTGGTAAAAATAAATAATAACA

Protein Sequence

>7306 : length: 537
MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSS
GRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGA
ACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFE
NISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQ
EPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLG
TLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVE
GYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNA
DISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSREFSVPEIIA
IAVVGALLLVALIFGTASYLIRARRSMDEANQPLLTDQYQCYAEEYEKLQNPNQSVV