ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

730249

Name

IRG1

Synonym

CAD;immunoresponsive 1 homolog (mouse);IRG1;immunoresponsive 1 homolog (mouse)

Definition

aconitate decarboxylase|cis-aconitate decarboxylase|cis-aconitic acid decarboxylase|immune-responsive gene 1 protein homolog

Position

13q22.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

730249

Links to epithelial mesenchymal transition gene database

730249

Links to ovarian cancer gene database

730249

Links to endometrial cancer gene database

730249

Links to iHOP

730249

Sequence Information

Nucleotide Sequence

>730249 : length: 2286
atgaaggcattttcccaagaaggccacctggcctctctaaactccccctcattactccct
gatagcaactggtcccaccccaggtttcatcctatcctaagagccaagcccaataatgcg
tggcatgccaccgtcccctctgaaaacgaagtgaccacggaagtcccacgagactccagc
agccctgaccacagccgattggacccacagcagacacggaatattctaacgtttagtgta
atccaaaatgagatgacagaggcaggagatgcaaatgccatgagaaggtcaagcagatca
gaagatattttggaaatagatgaacgcaaggaccacagacagctgagcagctgtgtgttt
attcccctcacgtttcgttccttcaggggccagggacagccatgtgttctttggcacaca
gggtgctgttcaggacttccagaggattccagggctccaccttcctgtatcaccagcagc
acggtctcatatggatggatggtgcaagtacctccagggctccatgtcaccaccccacct
cccccactgctccccagtctcacattcctccataagacacccctggaaagctttgccaca
gcaatccatggcttgaaagtgggacacctgacagatcgtgttattcagaggagcaagagg
atgattctagacactctgggtgctgggttcctgggaaccactacggaagtgtttcacata
gccagccaatatagcaagatctacagttccaacatatccagcactgtttggggtcagcca
gacatcaggctcccgcccacatatgctgcttttgtgaacggtgtggctattcactccatg
gattttgatgacacgtggcaccctgccacccacccttctggggctgtccttcctgtcctc
acagctttagcagaagccctgccaaggagtccaaagttttctggccttgacctgctgctg
gctttcaatgttggtattgaagtgcaaggccgattactgcatttcgccaaggaggccaat
gacatgccaaagagattccatcccccttccgtggtaggaacgttgggtagtgctgctgct
gcatccaagtttttaggacttagctcgacaaagtgccgagaagctctggccattgctgtt
tcccatgctggggcacccatggccaatgctgccacccagaccaagcccctccacattggc
aatgctgccaagcatgggatagaagctgcatttttggcaatgttgggtctccaaggaaac
aagcaggtcttggacttggaggcaggatttggggccttttatgccaactattccccaaaa
gtccttccaagcatagcttcctacagttggctgctggaccagcaggacgtggcctttaag
cgttttcctgcacatttatctacccactgggtggcagacgcagctgcatctgtgagaaag
caccttgtagcagagagagccctgcttccaactgactacattaagagaattgtgctcagg
ataccaaatgtccagtatgtaaacaggccctttccagtttcggagcatgaagcccgtcat
tcattccagtatgtggcctgtgccatgctgcttgatggtggcatcactgtcccctcattc
catgaatgccagatcaacaggccacaggtgagagagctgctcagtaaggtggagctggag
taccctccggacaacttgccaagcttcaacatactgtactgtgaaataagtgtcaccctc
aaggatggagccaccttcacagatcgctctgataccttctatgggcactggagaaaacca
ctgagccaggaggacctagaggaaaagttcagagccaatgcctccaagatgctgtcctgg
gacacagtggaaagccttataaagatagtcaaaaatctagaagacctagaagactgttct
gtgttaactacacttctcaaaggaccctctccaccagaggctgcagagggaagagaaagc
gcccccgtggcgcccccagggccgtgcagcccagacctagccccgcagccccacataccc
cagcacctccgaagctgcgtgcagagccgctcgctcccacctccggctgcacccgcgcgc
ccccttgcggcggattccgctctggcgcatagccccactggagcgctggcgcgttggcga
tggggtcccaggtgggagagagatctgtccgctgaacctgcgcatcccggcccctgcgga
ggctgcagagattctgccctttctgttcggagggaagagagagggcgccagggagacata
agctag

Protein Sequence

>730249 : length: 761
MKAFSQEGHLASLNSPSLLPDSNWSHPRFHPILRAKPNNAWHATVPSENEVTTEVPRDSS
SPDHSRLDPQQTRNILTFSVIQNEMTEAGDANAMRRSSRSEDILEIDERKDHRQLSSCVF
IPLTFRSFRGQGQPCVLWHTGCCSGLPEDSRAPPSCITSSTVSYGWMVQVPPGLHVTTPP
PPLLPSLTFLHKTPLESFATAIHGLKVGHLTDRVIQRSKRMILDTLGAGFLGTTTEVFHI
ASQYSKIYSSNISSTVWGQPDIRLPPTYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVL
TALAEALPRSPKFSGLDLLLAFNVGIEVQGRLLHFAKEANDMPKRFHPPSVVGTLGSAAA
ASKFLGLSSTKCREALAIAVSHAGAPMANAATQTKPLHIGNAAKHGIEAAFLAMLGLQGN
KQVLDLEAGFGAFYANYSPKVLPSIASYSWLLDQQDVAFKRFPAHLSTHWVADAAASVRK
HLVAERALLPTDYIKRIVLRIPNVQYVNRPFPVSEHEARHSFQYVACAMLLDGGITVPSF
HECQINRPQVRELLSKVELEYPPDNLPSFNILYCEISVTLKDGATFTDRSDTFYGHWRKP
LSQEDLEEKFRANASKMLSWDTVESLIKIVKNLEDLEDCSVLTTLLKGPSPPEAAEGRES
APVAPPGPCSPDLAPQPHIPQHLRSCVQSRSLPPPAAPARPLAADSALAHSPTGALARWR
WGPRWERDLSAEPAHPGPCGGCRDSALSVRREERGRQGDIS