ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

729873

Name

TBC1D3

Synonym

PRC17|TBC1D3A|TBC1D3F;TBC1 domain family, member 3;TBC1D3;TBC1 domain family, member 3

Definition

Rab GTPase-activating protein PRC17|TBC1 domain family member 3|TBC1 domain family, member 3F|prostate cancer gene 17 protein|protein TRE17-alpha

Position

17q12

Gene Type

protein-coding

External Links

Links to cell senescence gene database

729873

Links to epithelial mesenchymal transition gene database

729873

Links to ovarian cancer gene database

729873

Links to endometrial cancer gene database

729873

Links to iHOP

729873

Sequence Information

Nucleotide Sequence

>729873 : length: 2260
AGTGGTCTACAGCAGTTACACACAGGCAGTGGTATCTGTGAGCAGCTCTGTGGACTCAAA
GGTTTTCTCCCTGAGAGGCATGACCCAGGCCAGCTGATTCATCAGAATCAGGATGGACGT
GGTAGAGGTCGCGGGCAGTTGGTGGGCACAAGAGCGAGAGGACATCATTATGAAATACGA
AAAGGGACACCGAGCTGGGCTGCCAGAGGACAAGGGGCCTAAGCCTTTTCGAAGCTACAA
CAACAACGTCGATCATTTGGGGATTGTACATGAGACGGAGCTGCCTCCTCTGACTGCGCG
GGAGGCGAAGCAAATTCGGCGGGAGATCAGCCGAAAGAGCAAGTGGGTGGATATGCTGGG
AGACTGGGAGAAATACAAAAGCAGCAGAAAGCTCATAGATCGAGCGTACAAGGGAATGCC
CATGAACATCCGGGGCCCGATGTGGTCAGTCCTCCTGAACACTGAGGAAATGAAGTTGAA
AAACCCCGGAAGATACCAGATCATGAAGGAGAAGGGCAAGAGGTCATCTGAGCACATCCA
GCGCATCGACCGGGACGTAAGCGGGACATTAAGGAAGCATATATTCTTCAGGGATCGATA
CGGAACCAAGCAGCGGGAACTACTCCACATCCTCCTGGCATATGAGGAGTACAACCCGGA
GGTGGGCTACTGCAGGGACCTGAGCCACATCGCCGCCTTGTTCCTCCTCTATCTTCCTGA
GGAGGATGCATTCTGGGCACTGGTGCAGCTGCTGGCCAGTGAGAGGCACTCCCTGCAGGG
ATTTCACAGCCCAAATGGCGGGACCGTCCAGGGGCTCCAAGACCAACAGGAGCATGTGGT
AGCCACGTCACAACCCAAGACCATGGGGCATCAGGACAAGAAAGATCTATGTGGGCAGTG
TTCCCCGTTAGGCTGCCTCATCCGGATATTGATTGACGGGATCTCTCTCGGGCTCACCCT
GCGCCTGTGGGACGTGTATCTGGTAGAAGGCGAACAGGCGTTGATGCCGATAACAAGAAT
CGCCTTTAAGGTTCAGCAGAAGCGCCTCACGAAGACGTCCAGGTGTGGCCCGTGGGCACG
TTTTTGCAACCGGTTCGTTGATACCTGGGCCAGGGATGAGGACACTGTGCTCAAGCATCT
TAGGGCCTCTATGAAGAAACTAACAAGAAAGAAGGGGGACCTGCCACCCCCAGCCAAACC
CGAGCAAGGGTCGTCGGCATCCAGGCCTGTGCCGGCTTCACGTGGCGGGAAGACCCTCTG
CAAGGGGGACAGGCAGGCCCCTCCAGGCCCACCAGCCCGGTTCCCGCGGCCCATTTGGTC
AGCTTCCCCGCCACGGGCACCTCGTTCTTCCACACCCTGTCCTGGTGGGGCTGTCCGGGA
AGACACCTACCCTGTGGGCACTCAGGGTGTGCCCAGCCCGGCCCTGGCTCAGGGAGGACC
TCAGGGTTCCTGGAGATTCCTGCAGTGGAACTCCATGCCCCGCCTCCCAACGGACCTGGA
CGTAGAGGGCCCTTGGTTCCGCCATTATGATTTCAGGCAGAGCTGCTGGGTCCGTGCCAT
ATCCCAGGAGGACCAGCTGGCCCCCTGCTGGCAGGCTGAACACCCTGCGGAGCGGGTGAG
ATCGGCTTTCGCTGCACCCAGCACTGATTCCGACCAGGGCACCCCCTTCAGAGCTAGGGA
CGAACAGCAGTGTGCTCCCACCTCAGGGCCTTGCCTCTGCGGCCTCCACTTGGAAAGTTC
TCAGTTCCCTCCAGGCTTCTAGAAGCATCTGGGCCAGGGCTCATGGCTGGATAATTTCCC
TAGGCTTAACAACCCAAGCAAGCTTCGCATCCTCGTTTTATTTTTGGTTAAACTTATGAA
AATGTATTAAGAAAGAGTGCAGCTCGAGAGAGATTCAGAGATGGAACACACCAGACCCCA
GATCACAAAGCCAACCATGCCCAGCCCCTCCCAGCACCCCCAGCCCCACGACCATCGTTC
TGAATTCTGACGACACCGTGAGCCTGCCTTTGTACTTCAAACTCATGGAAGGATAACCAC
CTTCATGTTTTGAAATAAATGTTTCCTGTTGAAATGATTTTAGATTTTAGACAGAAATAT
TGAAAAGGCACTATAGTATCCTCCTATACCTTCCATCCAGCTGCCCCTAATAATGATGTT
TTGCAGTCCCATGGCACATAAGAAATTTAGGCCGGGTGTGGTGGCTCACACCTGTAATCC
CAGCAATTTGAGAGGTCGAGGCGGGAGGTTCAGGTTCACT

Protein Sequence

>729873 : length: 549
MDVVEVAGSWWAQEREDIIMKYEKGHRAGLPEDKGPKPFRSYNNNVDHLGIVHETELPPL
TAREAKQIRREISRKSKWVDMLGDWEKYKSSRKLIDRAYKGMPMNIRGPMWSVLLNIEEM
KLKNPGRYQIMKEKGKRSSEHIQRIDRDVSGTLRKHIFFRDRYGTKQRELLHILLAYEEY
NPEVGYCRDLSHIAALFLLYLPEEDAFWALVQLLASERHSLQGFHSPNGGTVQGLQDQQE
HVVATSQPKTMGHQDKKDLCGQCSPLGCLIRILIDGISLGLTLRLWDVYLVEGEQALMPI
TRIAFKVQQKRLTKTSRCGPWARFCNRFVDTWARDEDTVLKHLRASMKKLTRKQGDLPPP
AKPEQGSSASRPVPASRGGKTLCKGDRQAPPGPPARFPRPIWSASPPRAPRSSTPCPGGA
VREDTYPVGTQGVPSPALAQGGPQGSWRFLQWNSMPRLPTDLDVEGPWFRHYDFRQSCWV
RAISQEDQLAPCWQAEHPAERVRSAFAAPSTDSDQGTPFRARDEQPCAPTSGPCLCGLHL
ESSQFPPGF