ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

729533

Name

FAM72A

Synonym

LMPIP;family with sequence similarity 72, member A;FAM72A;family with sequence similarity 72, member A

Definition

LMP1-induced protein|RP11-312O7.1|Ugene|latent membrane protein 1-induced protein|protein FAM72A

Position

1q32.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

729533

Links to epithelial mesenchymal transition gene database

729533

Links to ovarian cancer gene database

729533

Links to endometrial cancer gene database

729533

Links to iHOP

729533

Sequence Information

Nucleotide Sequence

>729533 : length: 2377
GCCGAGGCGTGGTCACAGATTAAGCTCCACCCCGGGTTGTTGAACCCCTAAGTAGAACTG
ATGGGCGGGATTAAGGTGGAACCGACGACCAAACACAAACTCTTGAGCTAAGGCACGGCC
AATTGGGCCGGGGTAGAGAGGAGGGGTGTTGCGGGGAGTTTTAACCAATAAAGAGTAGAG
ACCGGTGGAGACTGTAGAACCTCTTCCAATAAGAAGCGGGAAGGGCGTGCCTTGCCACTT
TCACTAGGGCGAAGGCAGGGTTTGCCGAAACCTCCCGAAGCCGGCCAATGAGATCGGAGG
CGGAGCCAAGCTCAGCCAACCAGAAAGCCGAATTGATCTCAGCACCGTTACTGGGGCGGT
GCCTACGGTCTTCAAGCCACTAAGCTCTCGTGAGGGGAGGCCCCGGAGCCTTCCAATGAG
GGACTGGGGCTAACTCTAGTTCTTCCAATCGGTGCGCGGCGCTGGCAATTCAAACTGATA
CCGGGTTGGAGAGGCAGGAAAAGCGGAAGAGGGAGCGAAAACCAACGTGTTCGGTGACAG
ACCCCAGCGCCGACTGAGCCTCTAAAGCGACTTCAGCTCTGCCCCACCAACACCACCGCG
CGCCCGGGAACAGCCGCTCCGGGAAGAAACCTGAGGGGACTGCGGGGGGCACGAGGGACA
GCTGAGGGAAGGGAGGACGCGAGAGAAACAGCGCGAGCACGCTGAGGGCCGGGGGTTGCC
AGGAGAGGGGCCCGCGGACCCGCAGAGCGGAGGAAGGTCCGGGAGAAAAGGGGCGGGACG
GAGGAGAATCCGGGATCGCCTGGCAGAAAAAGAGAAGGGAGTTTCTGAATCCTGGGAAGA
GGAGGCGTGGTTTCAAGGACAGGTGCGTGTCCATCCTGTGTTGCAAATTCTGTAAACAAG
TGCTCAGCTCTAGGGGAATGAAGGCTGTTTTGCTGGCTGATACTGAAATAGACCTTTTCT
CTACAGACATCCCTCCTACCAACGCAGTGGACTTCACTGGAAGATGCTATTTCACCAAAA
TCTGCAAATGTAAACTGAAGGACATCGCATGTTTAAAATGTGGGAACATTGTAGGTTATC
ATGTGATTGTTCCATGTAGTTCCTGTCTTCTTTCCTGCAACAACGGACACTTCTGGATGT
TTCACAGCCAGGCAGTTTATGATATTAACAGACTAGACTCCACAGGTGTAAACGTCCTAC
TTTGGGGCAACTTGCCAGAGATAGAAGAGAGTACAGATGAAGATGTGTTAAATATCTCAG
CAGAGGAGTGTATTAGATAAATGGAATTATGATATATATGATATACAAACTTTTTTCTAT
TTAAAAATATATTAATGGATCAACTTTAAAATTGTTAGTTGCCAGTGATCTTTTTTGGAA
AACAAAAATGGGGCATTTGTTGATTTATTTATTTTCCGTCTCTAATTAGTTACCTCAGTT
TGATTGAAGCCAGTGAAGTTGTGCTTTTCCTCTACTTCTACTTCCTCTCCCCGACCTTTT
TCTGCCCAGTGTAGGTGTATTCTTAAATTCAGACAGGGGAAGATTCTTTCACATATCACT
CAGTTACCTCCCAATCTGGGGGAGTTTTTCTTACAACTTGATACCAGATACCATTAATTT
TACATTCCTGAATAAAGGCCTAGTACCCACGCATATTTCAACCATGCATATATCAAGTTC
AACCGAGTTTTAATAGGGGATTAAAAAAACAAGCTGTTAGGTTTCCATGGGCACTGGTTC
TCATAGGTTCTATTGGTGATAACTGCTTTAACATGGAGCAAGAGTTTGTGAATCAGGAAA
TAGAATAAATTAAAATTTAAAATATATAGAGGAATCCTCTTGATTGCTCAGCATGATGTT
AGATAAATGAGTTTGTCAGAAAATATCAGTATACGCTGTTTACCAATGTTATTTATTTAC
ATTCTTCTAAAGCCATTATGGATATTGTATTATGAGAGCTAAACCTAAATAAGTTATCCT
GTTCCCTAGGACCTTCTCTGTAAATAGTGAATTTTAGACGAGTAGTCTGTCCTAAATCTT
AAATAGAAAAAAAACTAAAGCGATTTGCTTAAGCCATTGTACATTATAAAGAGCTGTTTT
GTTTTGCTTTGCTTTGCTTTGTTTTGTTTTTTTAAAGCTGCATTCAGAGCCACAAAGGAA
TAGGAAAGTAGGGTAGTGTTGGATTCTGGTTTTATGTAACTCTAAAATAAATGTATCTCT
TTAATATCTCAGTTGTAGGGATTTTGTCAATACCAAAGCAGACTGAGTTGTGGTTTTGTA
AATAAAGTTTTTTCTAAAAATGACCATTCTTCCTTTAATTTTTTGTTATGCCCACATATT
GTATGTAAAAATATAAATAAATAGTACTTAAAGTATA

Protein Sequence

>729533 : length: 149
MPTTTALRWTAAARVRRKGRGGWVPAALRSVSQDGVPGCTVMGGETRSPENAVDFTGRCY
FTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGV
NVLLWGNLPEIEESTDEDVLNISAEECIR