ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7295

Name

TXN

Synonym

TRDX|TRX|TRX1;thioredoxin;TXN;thioredoxin

Definition

ADF|ATL-derived factor|SASP|TXN delta 3|surface-associated sulphydryl protein|thioredoxin delta 3

Position

9q31

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

TNF receptor signaling pathway;PID Curated;200086

Pathway

Hypoxia response via HIF activation;PANTHER;P00030

Pathway

p38 MAPK signaling pathway;PID Curated;200014

Pathway

Synthesis and interconversion of nucleotide di- and triphosphates;PID Reactome;500233

Pathway

Oxidative stress response;PANTHER;P00046

Pathway

Metabolism of nucleotides;Reactome;REACT:1698

Disease

Diabetes mellitus;FunDO

Disease

Prostate cancer;FunDO

Disease

Sicca syndrome;FunDO

Disease

Cystic fibrosis;FunDO

Disease

Infectious lung disease;FunDO

Disease

HTLV-I infection;FunDO

Disease

Lung cancer;FunDO

Disease

Liver metastases;FunDO

Disease

Colon cancer;FunDO

Disease

Vascular disease;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to cell senescence gene database

7295

Links to epithelial mesenchymal transition gene database

7295

Links to ovarian cancer gene database

7295

Links to endometrial cancer gene database

7295

Links to iHOP

7295

Sequence Information

Nucleotide Sequence

>7295 : length: 886
CTCGCAGGCTCCAGGGGCGGGGCGTGGCCGGGGCGCAGCGACGGGCGCGGAGGTCCGGCC
GGGCGCGCGCGCCCCCGCCACACGCACGCCGGGCGTGCCAGTTTATAAAGGGAGAGAGCA
AGCAGCGAGTCTTGAAGCTCTGTTTGGTGCTTTGGATCCATTTCCATCGGTCCTTACAGC
CGCTCGTCAGACTCCAGCAGCCAAGATGGTGAAGCAGATCGAGAGCAAGACTGCTTTTCA
GGAAGCCTTGGACGCTGCAGGTGATAAACTTGTAGTAGTTGACTTCTCAGCCACGTGGTG
TGGGCCTTGCAAAATGATCAAGCCTTTCTTTCATTCCCTCTCTGAAAAGTATTCCAACGT
GATATTCCTTGAAGTAGATGTGGATGACTGTCAGGATGTTGCTTCAGAGTGTGAAGTCAA
ATGCATGCCAACATTCCAGTTTTTTAAGAAGGGACAAAAGGTGGGTGAATTTTCTGGAGC
CAATAAGGAAAAGCTTGAAGCCACCATTAATGAATTAGTCTAATCATGTTTTCTGAAAAT
ATAACCAGCCATTGGCTATTTAAAACTTGTAATTTTTTTAATTTACAAAAATATAAAATA
TGAAGACATAAACCCAGTTGCCATCTGCGTGACAATAAAACATTAATGCTAACACTTTTT
AAAACCGTCTCATGTCTGAATAGCTTTCAAAATAAATGTGAAATGGTCATTTAATGTATT
TTCCTATATTCTCAATCACTTTTTAGTAACCTTGTAGGCCACTGATTATTTTAAGATTTT
AAAAATTATTATTGCTACCTTAATGTATTGCTACAAAAATCTCTTGTTGGGGGCAATGCA
GGTAATAAAGTAGTATGTTGTTATTTGTAAAAAAAAAAAAAAAAAA

Protein Sequence

>7295 : length: 105
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD
DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV