ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7291

Name

TWIST1

Synonym

ACS3|BPES2|BPES3|CRS|CRS1|CSO|SCS|TWIST|bHLHa38;twist family bHLH transcription factor 1;TWIST1;twist family bHLH transcription factor 1

Definition

B-HLH DNA binding protein|H-twist|TWIST homolog of drosophila|class A basic helix-loop-helix protein 38|twist basic helix-loop-helix transcription factor 1|twist homolog 1|twist-related protein 1

Position

7p21.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Notch-mediated HES/HEY network;PID Curated;200196

Pathway

HIF-2-alpha transcription factor network;PID Curated;200030

Pathway

tumor suppressor arf inhibits ribosomal biogenesis;PID BioCarta;100237

Disease

non-small cell lung carcinoma;GAD

Disease

Enteritis;FunDO

Disease

CANCER;GAD

Disease

Craniosynostosis, type 1;OMIM

Disease

Saethre-Chotzen syndrome;OMIM

Disease

Craniosynostosis;FunDO

Disease

Cancer;FunDO

Disease

Rheumatism;FunDO

Disease

Ptosis;FunDO

Disease

Saethre-Chotzen syndrome with eyelid anomalies;OMIM

Disease

craniosynostosis;GAD

Disease

Hyperopia;FunDO

Disease

Ulcerative colitis;FunDO

External Links

Links to cell senescence gene database

7291

Links to epithelial mesenchymal transition gene database

7291

Links to ovarian cancer gene database

7291

Links to endometrial cancer gene database

7291

Links to iHOP

7291

Sequence Information

Nucleotide Sequence

>7291 : length: 1669
GAGGTATAAGAGCCTCCAAGTCTGCAGCTCTCGCCCAACTCCCAGACACCTCGCGGGCTC
TGCAGCACCGGCACCGTTTCCAGGAGGCCTGGCGGGGTGTGCGTCCAGCCGTTGGGCGCT
TTCTTTTTGGACCTCGGGGCCATCCACACCGTCCCCTCCCCCTCCCGCCTCCCTCCCCGC
CTCCCCCGCGCGCCCTCCCCGCGGAGGTCCCTCCCGTCCGTCCTCCTGCTCTCTCCTCCG
CGGGCCGCATCGCCCGGGCCGGCGCCGCGCGCGGGGGAAGCTGGCGGGCTGAGGCGCCCC
GCTCTTCTCCTCTGCCCCGGGCCCGCGAGGCCACGCGTCGCCGCTCGAGAGATGATGCAG
GACGTGTCCAGCTCGCCAGTCTCGCCGGCCGACGACAGCCTGAGCAACAGCGAGGAAGAG
CCAGACCGGCAGCAGCCGCCGAGCGGCAAGCGCGGGGGACGCAAGCGGCGCAGCAGCAGG
CGCAGCGCGGGCGGCGGCGCGGGGCCCGGCGGAGCCGCGGGTGGGGGCGTCGGAGGCGGC
GACGAGCCGGGCAGCCCGGCCCAGGGCAAGCGCGGCAAGAAGTCTGCGGGCTGTGGCGGC
GGCGGCGGCGCGGGCGGCGGCGGCGGCAGCAGCAGCGGCGGCGGGAGTCCGCAGTCTTAC
GAGGAGCTGCAGACGCAGCGGGTCATGGCCAACGTGCGGGAGCGCCAGCGCACCCAGTCG
CTGAACGAGGCGTTCGCCGCGCTGCGGAAGATCATCCCCACGCTGCCCTCGGACAAGCTG
AGCAAGATTCAGACCCTCAAGCTGGCGGCCAGGTACATCGACTTCCTCTACCAGGTCCTC
CAGAGCGACGAGCTGGACTCCAAGATGGCAAGCTGCAGCTATGTGGCTCACGAGCGGCTC
AGCTACGCCTTCTCGGTCTGGAGGATGGAGGGGGCCTGGTCCATGTCCGCGTCCCACTAG
CAGGCGGAGCCCCCCACCCCCTCAGCAGGGCCGGAGACCTAGATGTCATTGTTTCCAGAG
AAGGAGAAAATGGACAGTCTAGAGACTCTGGAGCTGGATAACTAAAAATAAAAATATATG
CCAAAGATTTTCTTGGAAATTAGAAGAGCAAAATCCAAATTCAAAGAAACAGGGCGTGGG
GCGCACTTTTAAAAGAGAAAGCGAGACAGGCCCGTGGACAGTGATTCCCAGACGGGCAGC
GGCACCATCCTCACACCTCTGCATTCTGATAGAAGTCTGAACAGTTGTTTGTGTTTTTTT
TTTTTTTTTTTTTGACGAAGAATGTTTTTATTTTTATTTTTTTCATGCATGCATTCTCAA
GAGGTCGTGCCAATCAGCCACTGAAAGGAAAGGCATCACTATGGACTTTCTCTATTTTAA
AATGGTAACAATCAGAGGAACTATAAGAACACCTTTAGAAATAAAAATACTGGGATCAAA
CTGGCCTGCAAAACCATAGTCAGTTAATTCTTTTTTTCATCCTTCCTCTGAGGGGAAAAA
CAAAAAAAAACTTAAAATACAAAAAACAACATTCTATTTATTTATTGAGGACCCATGGTA
AAATGCAAATAGATCCGGTGTCTAAATGCATTCATATTTTTATGATTGTTTTGTAAATAT
CTTTGTATATTTTTCTGCAATAAATAAATATAAAAAATTTAGAGAAAAA

Protein Sequence

>7291 : length: 202
MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGV
GGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQR
TQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAH
ERLSYAFSVWRMEGAWSMSASH