ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7258

Name

TSPY1

Synonym

CT78|DYS14|TSPY|pJA923;testis specific protein, Y-linked 1;TSPY1;testis specific protein, Y-linked 1

Definition

cancer/testis antigen 78|testis-specific Y-encoded protein 1

Position

Yp11.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

7258

Links to epithelial mesenchymal transition gene database

7258

Links to ovarian cancer gene database

7258

Links to endometrial cancer gene database

7258

Links to iHOP

7258

Sequence Information

Nucleotide Sequence

>7258 : length: 1182
GGCCCTTCGCGCGCAGTCCCTTAGGGGGCGCCTGGAAGCCCGGCGCATGCGCCCTGAGGG
CTCGCTGACCTACCGGGTGCCAGAGAGGCTGCGGCAGGGTTTCTGTGGCGTGGGTCGGGC
AGCACAGGCCTTGGTGTGTGCGAGTGCCAAGGAGGGCACCGCCTTCAGGATGGAGGCTGT
GCAGGAGGGGGCGGCCGGGGTGGAGAGTGAGCAGGCGGCTTTGGGGGAGGAGGCGGTGCT
GCTGTTGGATGACATAATGGCGGAGGTGGAGGTGGTGGCGGAGGAGGAGGGCCTCGTGGA
GCGGCGGGAGGAGGCCCAGCGGGCACAGCAGGCTGTGCCTGGCCCTGGGCCCATGACCCC
AGAGTCTGCACCGGAGGAGCTGCTGGCCGTTCAGGTGGAGCTGGAGCCGGTTAATGCCCA
AGCCAGGAAGGCCTTTTCTCGGCAGCGGGAAAAGATGGAGCGGAGGCGCAAGCCCCACCT
AGACCGCAGAGGCGCCGTCATCCAGAGCGTCCCTGGCTTCTGGGCCAATGTTATTGCAAA
CCACCCCCAGATGTCAGCCCTGATCACTGACGAAGATGAAGACATGCTGAGCTACATGGT
CAGCCTGGAGGTGGGAGAAGAGAAGCATCCTGTTCATCTCTGCAAGATCATGTTGTTCTT
TCGGAGTAACCCCTACTTCCAGAATAAAGTGATTACCAAGGAATATCTGGTGAACATCAC
AGAATACAGGGCTTCTCATTCCACTCCAATTGAGTGGTATCCGGATTATGAAGTGGAGGC
CTATCGCCGCAGACACCACAACAGCAGCCTTAACTTCTTCAACTGGTTCTCTGACCACAA
CTTCGCAGGATCTAACAAGATTGCTGAGTCCCCTGACAGATCCTATGTAAGGACCTGTGG
CGCAATCCCCTGCAATACTACAAGAGGATGAAGCCACCTGAAGAGGGAACAGAGACGTCA
GGGGACTCCCAGTTGTTGAGTTGAATATGATGGAGCATCAGATTTTACCTAATACAGCAG
AACTCCTAAAAAGTTACAGCCATATGCAGGACGGCAGTACTCAGCATGGTCTTATGCACA
GGAACTAAAGGAAAAAGAGATCGAGTCACAAAAATTCAGGAAGAGGGGGTAAATGTGGAT
TGTATGGAATGAAAAATAAACATTCTCAAGGAAAAAAAAAAA

Protein Sequence

>7258 : length: 308
MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALG
EEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESAPEELLAVQVELE
PVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDM
LSYMVSLEVGEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPD
YEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTET
SGDSQLLS