ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7205

Name

TRIP6

Synonym

OIP-1|OIP1|TRIP-6|TRIP6i2|ZRP-1;thyroid hormone receptor interactor 6;TRIP6;thyroid hormone receptor interactor 6

Definition

OPA-interacting protein 1|TR-interacting protein 6|thyroid hormone receptor interacting protein 6|thyroid receptor-interacting protein 6|zyxin related protein 1

Position

7q22

Gene Type

protein-coding

Pathways and Diseases

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

Pathway

AP-1 transcription factor network;PID Curated;200118

Disease

Carcinoma;FunDO

External Links

Links to cell senescence gene database

7205

Links to epithelial mesenchymal transition gene database

7205

Links to ovarian cancer gene database

7205

Links to endometrial cancer gene database

7205

Links to iHOP

7205

Sequence Information

Nucleotide Sequence

>7205 : length: 1762
GACGTCATCGGAGGCGTGGTCGTCCCCAAAATTAGGGAGGAAGAGGAAAAAAAAAAGCCA
GAAAAAGTTTTCTTTTCTGGAGTCCCAAACGAGGTGCGGGACGGAAGAGGGGGTGAAGGC
CAGAGGCTCGGGGCTTCAAGACCGCTGTCTGGAGTCCCCCTTTCCAGGCCATGTCGGGGC
CCACCTGGCTGCCCCCGAAGCAGCCGGAGCCCGCCAGAGCCCCTCAGGGGAGGGCGATCC
CCCGCGGCACCCCGGGGCCACCACCGGCCCACGGAGCAGCACTCCAGCCCCACCCCAGGG
TCAATTTTTGCCCCCTTCCATCTGAGCAGTGTTACCAGGCCCCAGGGGGACCGGAGGATC
GGGGGCCGGCGTGGGTGGGGTCCCATGGAGTACTCCAGCACACGCAGGGGCTCCCTGCAG
ACAGGGGGGGCCTTCGCCCTGGAAGCCTGGACGCCGAGATAGACTTGCTGAGCAGCACGC
TGGCCGAGCTGAATGGGGGTCGGGGTCATGCGTCACGGCGACCAGACCGACAGGCATATG
AGCCCCCGCCACCTCCTGCCTACCGCACGGGCTCCCTGAAGCCAAATCCAGCCTCGCCGC
TCCCAGCGTCTCCCTATGGGGGCCCCACTCCAGCCTCTTACACTACCGCCAGCACCCCGG
CTGGCCCAGCCTTCCCCGTGCAAGTGAAGGTGGCACAGCCAGTGAGGGGCTGCGGCCCAC
CCAGGCGGGGAGCCTCTCAGGCCTCTGGGCCCCTCCCGGGCCCCCACTTTCCTCTCCCAG
GCCGAGGTGAAGTCTGGGGGCCTGGCTATAGGAGCCAGAGAGAGCCAGGGCCAGGGGCCA
AAGAGGAAGCTGCTGGGGTCTCTGGCCCTGCAGGAAGAGGAAGAGGAGGCGAGCACGGGC
CCCAGGTGCCCCTGAGCCAGCCTCCAGAGGATGAGCTGGATAGGCTGACGAAGAAGCTGG
TTCACGACATGAACCACCCGCCCAGCGGGGAGTACTTTGGCCAGTGTGGTGGCTGCGGAG
AAGATGTGGTTGGGGATGGGGCTGGGGTTGTGGCCCTTGATCGCGTCTTTCACGTGGGCT
GCTTTGTATGTTCTACATGCCGGGCCCAGCTTCGCGGCCAGCATTTCTACGCCGTGGAGA
GGAGGGCATATTGCGAGGGCTGCTACGTGGCCACCCTGGAGAAATGTGCCACGTGCTCCC
AGCCCATCCTGGACCGGATCCTGCGGGCTATGGGGAAGGCCTACCACCCTGGCTGCTTCA
CCTGCGTGGTGTGTCACCGCGGCCTCGACGGCATCCCCTTCACAGTGGATGCTACGAGCC
AGATCCACTGCATTGAGGACTTTCACAGGAAGTTTGCCCCAAGATGCTCAGTGTGCGGTG
GGGCCATAATGCCTGAGCCAGGTCAGGAGGAGACTGTGAGAATTGTTGCTCTGGATCGAA
GTTTTCACATTGGCTGTTACAAGTGCGAGGAGTGTGGGCTGCTGCTCTCCTCTGAGGGCG
AGTGTCAGGGCTGCTACCCGCTGGATGGGCACATCTTGTGCAAGGCCTGCAGCGCCTGGC
GCATCCAGGAGCTCTCAGCCACCGTCACCACTGACTGCTGAGTCTTCCTAGAAGTACCTG
CTGGGTTCTCAGTTCCAGTTCCCATCCTTTGATTGATCACTCTCCCTGACATCCACCTGT
ATGACTTTGTCACCAAATGCTGTCTTCTCTTTCTCCAATCAAGAAATAATAATCCCTCGA
GTTTACAAAACAAAAAAAAAAA

Protein Sequence

>7205 : length: 476
MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGG
PEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDR
QAYEPPPPPAYRTGSLKPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRG
CGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGRGRGG
EHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVALDRVF
HVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHP
GCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVA
LDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC