ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7204

Name

TRIO

Synonym

ARHGEF23|tgat;trio Rho guanine nucleotide exchange factor;TRIO;trio Rho guanine nucleotide exchange factor

Definition

PTPRF-interacting protein|triple functional domain (PTPRF interacting)|triple functional domain protein

Position

5p15.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Regulation of RhoA activity;PID Curated;200050

Pathway

Signaling by Rho GTPases;Reactome;REACT:11044

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Regulation of RAC1 activity;PID Curated;200165

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Netrin-mediated signaling;PID Curated;200074

Disease

Cancer;FunDO

Disease

Bladder cancer;FunDO

External Links

Links to cell senescence gene database

7204

Links to epithelial mesenchymal transition gene database

7204

Links to ovarian cancer gene database

7204

Links to endometrial cancer gene database

7204

Links to iHOP

7204

Sequence Information

Nucleotide Sequence

>7204 : length: 11134
ACGGGAAATTGGTCTTTGATCTGTGCCTGTCTCTGGCTGATTTGTACCTGGACCCTCCTC
GACCCCATTAGCAGCCGGGTTTCTTTGCTTGGCCCTCTAGCCTGTCATCTCCCCGGCCTT
GGTCTACACTTCTGTGAAACGGGGCAGTCACGGCACTCACTGCCCAGGGAGTGGGGACGG
TGGCCGAGCTGAAGCTCGGAGGACCGGGAGGCGCGGGTTTCGAAAAAACGATGAAATGAA
AGCTATGGATGTTTTACCAATTTTGAAGGAAAAAGTTGCATACCTTTCAGGTGGGAGAGA
TAAACGTGGAGGTCCCATTTTAACGTTTCCGGCCCGCAGCAATCATGACAGAATACGACA
GGAGGATCTCAGGAGACTCATTTCCTATCTAGCCTGTATTCCCAGCGAGGAGGTCTGCAA
GCGTGGCTTCACGGTGATCGTGGACATGCGTGGGTCCAAGTGGGACTCCATCAAGCCCCT
TCTGAAGATCCTGCAGGAGTCCTTCCCCTGCTGCATCCATGTGGCCCTGATCATCAAGCC
AGACAACTTCTGGCAGAAACAGAGGACTAATTTTGGCAGTTCTAAATTTGAATTTGAGAC
AAATATGGTCTCTTTAGAAGGCCTTACCAAAGTAGTTGATCCTTCTCAGCTAACTCCTGA
GTTTGATGGCTGCCTGGAATACAACCACGAAGAATGGATTGAAATCAGAGTTGCTTTTGA
AGACTACATTAGCAATGCCACCCACATGCTGTCTCGGCTGGAGGAACTTCAGGACATCCT
AGCTAAGAAGGAGCTGCCTCAGGATTTAGAGGGGGCTCGGAATATGATCGAGGAACATTC
TCAGCTGAAGAAGAAGGTGATTAAGGCCCCCATCGAGGACCTGGATTTGGAGGGACAGAA
GCTGCTTCAGAGGATACAGAGCAGTGAAAGCTTTCCCAAAAAGAACTCAGGCTCAGGCAA
TGCGGACCTGCAGAACCTCTTGCCCAAGGTGTCCACCATGCTGGACCGGCTGCACTCGAC
ACGGCAGCATCTGCACCAGATGTGGCATGTGAGGAAGCTGAAGCTGGACCAGTGCTTCCA
GCTGAGGCTGTTTGAACAGGATGCTGAGAAGATGTTTGACTGGATCACACACAACAAAGG
CCTGTTTCTAAACAGCTACACAGAGATTGGGACCAGCCACCCTCATGCCATGGAGCTTCA
GACGCAGCACAATCACTTTGCCATGAACTGTATGAACGTGTATGTAAATATAAACCGCAT
CATGTCGGTGGCCAATCGTCTGGTGGAGTCTGGCCACTATGCCTCGCAGCAGATCAGGCA
GATCGCGAGTCAGCTGGAGCAGGAGTGGAAGGCGTTTGCGGCAGCCCTGGATGAGCGGAG
CACCTTGCTGGACATGTCCTCCATTTTCCACCAGAAGGCCGAAAAGTATATGAGCAACGT
GGATTCATGGTGTAAAGCTTGCGGTGAGGTAGACCTTCCCTCAGAGCTGCAGGACCTAGA
AGATGCCATTCATCACCACCAGGGAATATATGAACATATCACTCTTGCTTATTCTGAGGT
CAGCCAAGATGGGAAGTCGCTCCTTGACAAGCTCCAGCGGCCCTTGACTCCCGGCAGCTC
CGATTCCCTGACAGCCTCTGCCAACTACTCCAAGGCCGTGCACCATGTCCTGGATGTCAT
CCACGAGGTGCTGCACCACCAGCGGCAGCTGGAGAACATCTGGCAACACCGCAAGGTCCG
GCTGCATCAGAGGCTGCAGCTGTGTGTTTTCCAGCAGGACGTTCAGCAGGTGCTAGACTG
GATCGAGAACCACGGAGAAGCATTTCTGAGCAAACATACAGGTGTGGGGAAATCTCTTCA
TCGGGCCAGAGCATTGCAGAAACGTCATGAAGATTTTGAAGAAGTGGCACAGAACACATA
CACCAATGCGGATAAATTACTGGAAGCAGCAGAACAGCTGGCTCAGACTGGGGAATGTGA
CCCCGAAGAGATTTATCAGGCTGCCCATCAGCTGGAAGACCGGATTCAAGATTTCGTTCG
GCGTGTTGAGCAGCGAAAGATCCTACTGGACATGTCAGTGTCCTTTCACACCCATGTGAA
AGAGCTGTGGACGTGGCTGGAGGAGCTGCAGAAGGAGCTGCTGGACGACGTGTATGCCGA
GTCGGTGGAGGCCGTGCAGGACCTCATCAAGCGCTTTGGCCAGCAGCAGCAGACCACCCT
GCAGGTGACTGTCAACGTGATCAAGGAAGGGGAGGACCTCATCCAGCAGCTCAGGGACTC
TGCCATCTCCAGTAACAAGACCCCCCACAACAGCTCCATCAACCACATTGAGACGGTGCT
GCAGCAGCTGGACGAGGCGCAGTCGCAGATGGAGGAGCTCTTCCAGGAGCGCAAGATCAA
GCTGGAGCTCTTCCTGCAGCTGCGCATCTTCGAGAGGGACGCCATCGACATTATCTCAGA
CCTCGAGTCTTGGAATGATGAGCTTTCTCAGCAAATGAATGACTTCGACACAGAAGATCT
CACGATTGCAGAGCAGCGCCTCCAGCACCATGCAGACAAAGCCTTGACCATGAACAACTT
GACTTTTGACGTCATCCACCAAGGGCAAGATCTTCTGCAGTATGTCAATGAGGTCCAGGC
CTCTGGTGTGGAGCTGCTGTGTGATAGAGATGTAGACATGGCAACTCGGGTCCAGGACCT
GCTGGAGTTTCTTCATGAAAAACAGCAGGAATTGGATTTAGCCGCAGAGCAGCATCGGAA
ACACCTGGAGCAGTGCGTGCAGCTGCGCCACCTGCAGGCAGAAGTGAAACAGGTGCTGGG
TTGGATCCGCAACGGAGAGTCCATGTTAAATGCCGGACTTATCACAGCCAGCTCGTTACA
AGAGGCAGAGCAGCTCCAGCGAGAGCACGAGCAGTTCCAGCATGCCATTGAGAAAACACA
TCAGAGCGCGCTGCAGGTGCAGCAGAAGGCAGAAGCCATGCTACAGGCCAACCACTACGA
CATGGACATGATCCGGGACTGCGCCGAGAAGGTGGCGTCTCACTGGCAACAGCTCATGCT
CAAGATGGAAGATCGCCTCAAGCTCGTCAACGCCTCTGTCGCTTTCTACAAAACCTCAGA
GCAGGTCTGCAGCGTCCTCGAGAGCCTGGAACAGGAGTACAAGAGAGAAGAAGACTGGTG
TGGCGGGGCGGATAAGCTGGGCCCAAACTCTGAGACGGACCACGTGACGCCCATGATCAG
CAAGCACCTGGAGCAGAAGGAGGCATTCCTGAAGGCTTGCACCCTTGCTCGGAGGAATGC
AGACGTCTTCCTGAAATACCTGCACAGGAACAGCGTGAACATGCCAGGAATGGTGACGCA
CATCAAAGCTCCTGAACAGCAAGTGAAAAATATCTTGAATGAACTCTTCCAACGGGAGAA
CAGGGTATTGCATTACTGGACCATGAGGAAGAGACGGCTGGACCAGTGTCAGCAGTACGT
GGTCTTTGAGAGGAGTGCCAAGCAGGCTTTGGAATGGATCCATGACAATGGCGAGTTCTA
CCTTTCCACACACACCTCCACGGGCTCCAGTATACAGCACACCCAGGAGCTCCTGAAAGA
GCACGAGGAGTTCCAGATAACTGCAAAGCAAACCAAAGAGAGAGTGAAGCTATTGATACA
GCTGGCTGATGGCTTTTGTGAAAAAGGGCATGCCCATGCGGCAGAGATAAAAAAATGTGT
TACTGCTGTGGATAAGAGGTACAGAGATTTCTCTCTGCGGATGGAGAAGTACAGGACCTC
TTTGGAAAAAGCCCTGGGGATTTCTTCAGATTCCAACAAATCGAGTAAAAGTCTCCAGCT
AGATATCATTCCAGCCAGTATCCCTGGCTCAGAGGTGAAACTTCGAGATGCTGCTCATGA
ACTTAATGAAGAGAAGCGGAAATCTGCCCGCAGGAAAGAGTTCATAATGGCTGAGCTCAT
TCAAACTGAAAAGGCTTATGTAAGAGACCTCCGGGAATGTATGGATACGTACCTGTGGGA
AATGACCAGTGGCGTGGAAGAGATTCCACCTGGCATTGTAAACAAAGAACTCATCATCTT
CGGAAACATGCAAGAAATCTACGAATTTCATAATAACATATTCCTAAAGGAGCTGGAAAA
ATATGAACAGTTGCCAGAGGATGTTGGACATTGTTTTGTTACTTGGGCAGACAAGTTTCA
GATGTATGTCACATATTGCAAAAATAAGCCTGATTCTACTCAGCTGATATTGGAACATGC
AGGGTCCTATTTTGACGAGATACAGCAGCGACATGGATTAGCCAATTCCATTTCTTCCTA
CCTTATTAAACCAGTTCAGCGAATAACGAAGTATCAGCTCCTTTTAAAAGAGCTGCTGAC
GTGCTGTGAGGAAGGAAAGGGAGAGATTAAAGATGGCCTGGAGGTGATGCTCAGCGTGCC
GAAGCGAGCCAATGATGCCATGCACCTCAGCATGCTGGAAGGGTTTGATGAAAACATTGA
GTCTCAGGGAGAACTCATCCTACAGGAATCCTTCCAAGTGTGGGACCCAAAAACCTTAAT
TCGAAAGGGTCGAGAACGGCATCTCTTCCTTTTTGAAATGTCCTTAGTATTTAGTAAAGA
AGTGAAAGATTCCAGTGGGAGAAGCAAGTACCTTTATAAAAGCAAATTGTTTACCTCAGA
GTTGGGTGTCACAGAACATGTTGAAGGAGACCCTTGCAAATTTGCACTGTGGGTGGGGAG
AACACCAACTTCAGATAATAAAATTGTCCTTAAGGCTTCCAGCATAGAGAACAAGCAGGA
CTGGATAAAGCATATCCGCGAAGTCATCCAGGAGCGGACGATCCACCTGAAGGGAGCCCT
GAAGGAGCCCATTCACATCCCTAAGACCGCTCCCGCCACAAGACAGAAGGGAAGGAGGGA
TGGAGAGGATCTGGACAGCCAAGGAGACGGCAGCAGCCAGCCTGATACGATTTCCATCGC
CTCACGGACGTCTCAGAACACGCTGGACAGCGATAAGCTCTCTGGTGGCTGTGAGCTGAC
AGTGGTGATCCATGACTTCACCGCTTGCAACAGCAACGAGCTGACCATCCGACGGGGCCA
GACCGTGGAAGTTCTGGAGCGGCCGCATGACAAGCCTGACTGGTGTCTGGTGCGGACAAC
TGACCGCTCCCCAGCGGCAGAAGGCCTGGTCCCCTGTGGTTCACTGTGCATCGCCCACTC
CAGAAGTAGCATGGAAATGGAGGGCATCTTCAACCACAAAGACTCGCTCTCCGTCTCCAG
CAATGACGCCAGTCCACCCGCATCCGTGGCTTCCCTCCAGCCCCACATGATCGGGGCCCA
GAGCTCGCCGGGCCCCAAGCGGCCGGGCAACACCCTGCGCAAGTGGCTCACCAGCCCCGT
GCGGCGGCTCAGCAGCGGCAAGGCCGACGGGCACGTGAAGAAGCTGGCGCACAAGCACAA
GAAGAGCCGCGAGGTCCGCAAGAGCGCCGACGCCGGCTCGCAGAAGGACTCCGACGACAG
TGCGGCCACCCCGCAGGACGAGACGGTCGAGGAGAGAGGCCGGAACGAGGGCCTGAGCAG
CGGTACTCTCTCCAAATCCTCCTCCTCGGGGATGCAGAGCTGTGGAGAAGAGGAAGGCGA
GGAGGGGGCCGACGCCGTGCCCCTGCCGCCACCCATGGCCATCCAGCAGCACAGCCTCCT
CCAGCCAGACTCACAGGATGACAAGGCCTCTTCTCGGTTATTAGTCCGCCCCACCAGCTC
CGAAACACCGAGTGCAGCCGAGCTCGTCAGTGCAATTGAGGAACTCGTGAAAAGCAAGAT
GGCACTGGAGGATCGCCCCAGCTCACTCCTTGTTGACCAGGGAGATAGTAGCAGCCCTTC
CTTCAACCCTTCGGATAATTCCCTTCTCTCTTCCTCCTCGCCCATTGATGAGATGGAAGA
AAGGAAATCCAGCTCTTTAAAGAGAAGACACTACGTTTTGCAAGAACTAGTGGAGACAGA
GCGTGACTATGTGCGGGACCTTGGCTATGTGGTTGAGGGCTACATGGCACTTATGAAAGA
AGATGGTGTTCCTGATGACATGAAAGGAAAAGACAAAATTGTGTTCGGCAACATCCATCA
GATTTACGACTGGCACAGAGACTTTTTTTTAGGAGAGTTAGAGAAGTGCCTTGAAGATCC
AGAAAAACTAGGATCCCTTTTTGTTAAACACGAGAGAAGGTTGCACATGTACATAGCTTA
TTGTCAAAATAAACCAAAGTCTGAGCACATTGTCTCAGAATACATTGATACCTTTTTTGA
GGACTTAAAGCAGCGTCTTGGCCACAGGTTACAGCTCACAGATCTGTTGATCAAACCAGT
GCAGAGAATCATGAAGTATCAGCTGTTACTGAAGGACTTCCTCAAGTATTCCAAAAAGGC
CAGCCTGGATACATCAGAATTAGAGAGAGCTGTGGAAGTCATGTGCATAGTACCCAGGCG
GTGCAACGACATGATGAACGTGGGGCGGCTGCAAGGATTCGACGGGAAAATCGTTGCCCA
GGGTAAACTGCTCTTGCAGGACACATTCTTGGTCACAGACCAAGATGCAGGACTTCTGCC
TCGCTGCAGAGAGAGGCGCATCTTCCTCTTTGAGCAGATCGTCATATTCAGCGAACCACT
TGATAAAAAGAAGGGCTTCTCCATGCCGGGATTCCTGTTTAAGAACAGTATCAAGGTGAG
TTGCCTTTGCCTGGAGGAAAATGTGGAAAATGATCCCTGTAAATTTGCTCTGACATCGAG
GACGGGTGACGTGGTAGAGACCTTCATTTTGCATTCATCTAGTCCAAGTGTCCGGCAAAC
TTGGATCCATGAAATCAACCAAATTTTAGAAAACCAGCGCAATTTTTTAAATGCCTTGAC
ATCGCCAATCGAGTACCAGAGGAACCACAGCGGGGGCGGCGGCGGCGGCGGCAGCGGGGG
CAGCGGCGGGGGTGGGGGCAGCGGCGGCGGCGGGGCCCCCAGTGGCGGCAGCGGCCACAG
TGGCGGCCCCAGCAGCTGCGGCGGCGCCCCCAGCACGAGCAGGAGCCGGCCCTCCCGGAT
CCCCCAGCCTGTCCGACACCACCCCCCCGTGCTGGTCTCCTCTGCAGCCTCGAGCCAGGC
AGAGGCAGACAAGATGTCAGGTACGTCCACCCCCGGGCCCTCCCTGCCTCCCCCTGGCGC
GGCCCCCGAGGCCGGCCCCAGCGCGCCCAGCAGGCGGCCCCCCGGCGCGGACGCCGAGGG
GTCCGAGCGAGAAGCGGAGCCGATCCCCAAGATGAAGGTGCTGGAGAGCCCCAGGAAAGG
CGCCGCGAACGCCTCGGGGTCGAGCCCAGACGCCCCCGCCAAGGACGCGCGCGCTAGCCT
GGGCACCCTGCCGCTTGGGAAGCCCCGGGCCGGGGCCGCTTCGCCGCTGAACTCGCCGCT
CTCCAGCGCGGTCCCTTCTCTCGGCAAGGAGCCCTTCCCCCCCAGCAGCCCCCTGCAGAA
GGGGGGCTCCTTCTGGAGCTCCATCCCCGCCTCCCCCGCCAGCCGACCCGGCTCCTTCAC
CTTCCCGGGGGACAGCGACTCCCTCCAGCGGCAGACACCCCGCCACGCGGCCCCTGGCAA
GGATACTGACCGCATGAGCACGTGCTCCTCGGCCAGCGAGCAGTCCGTGCAGTCCACCCA
GAGCAACGGGAGTGAAAGCAGCAGCAGTAGCAACATCTCCACCATGTTGGTGACACACGA
TTACACGGCAGTGAAGGAGGATGAGATCAACGTCTACCAAGGAGAGGTCGTTCAAATTCT
GGCCAGCAACCAGCAGAACATGTTTCTGGTGTTCCGAGCCGCCACTGACCAGTGCCCCGC
AGCTGAGGGCTGGATTCCAGGCTTTGTCCTGGGCCACACCAGTGCAGTCATCGTGGAGAA
CCCGGACGGGACTCTCAAGAAGTCAACATCTTGGCACACAGCACTCCGTTTAAGGAAAAA
ATCTGAGAAAAAAGATAAAGACGGCAAAAGGGAAGGCAAGTTAGAGAACGGTTATCGGAA
GTCACGGGAAGGACTCAGCAACAAGGTATCTGTGAAGCTTCTCAATCCCAACTACATTTA
TGACGTTCCCCCAGAATTCGTCATTCCATTGAGTGAGGTCACGTGTGAGACAGGGGAGAC
CGTTGTTCTTAGATGTCGAGTCTGTGGCCGCCCCAAAGCCTCAATTACCTGGAAGGGCCC
TGAACACAACACCTTGAACAACGATGGTCACTACAGCATCTCCTACAGTGACCTGGGAGA
GGCCACGCTGAAGATTGTGGGCGTGACCACGGAAGATGACGGCATCTACACGTGCATCGC
TGTCAATGACATGGGTTCAGCCTCATCGTCGGCCAGCCTGAGGGTCCTAGGTCCAGGGAT
GGATGGGATCATGGTGACCTGGAAAGACAACTTTGACTCCTTCTACAGTGAAGTGGCTGA
GCTTGGCAGGGGCAGATTCTCTGTCGTTAAGAAATGTGATCAGAAAGGAACCAAGCGAGC
AGTGGCCACTAAGTTTGTGAACAAGAAGTTGATGAAGCGCGACCAGGTCACCCATGAGCT
TGGCATCCTGCAGAGCCTCCAGCACCCCCTGCTTGTCGGCCTCCTCGACACCTTTGAGAC
CCCCACCAGCTACATCCTGGTCTTAGAAATGGCTGACCAGGGTCGCCTCCTGGACTGCGT
GGTGCGATGGGGAAGCCTCACTGAAGGGAAGATCAGGGCGCACCTGGGGGAGGTTCTGGA
AGCTGTCCGGTACCTGCACAACTGCAGGATAGCACACCTGGACCTAAAGCCTGAGAATAT
CCTGGTGGATGAGAGTTTAGCCAAGCCAACCATCAAACTGGCTGACTTTGGAGATGCTGT
TCAGCTCAACACGACCTACTACATCCACCAGTTACTGGGGAACCCTGAATTCGCAGCCCC
TGAAATCATCCTCGGGAACCCTGTCTCCCTGACCTCGGATACGTGGAGTGTTGGAGTGCT
CACATACGTACTTCTTAGTGGCGTGTCCCCCTTCCTGGATGACAGTGTGGAAGAGACCTG
CCTGAACATTTGCCGCTTAGACTTTAGCTTCCCAGATGACTACTTTAAAGGAGTGAGCCA
GAAGGCCAAGGAGTTCGTGTGCTTCCTCCTGCAGGAGGACCCCGCCAAGCGTCCCTCGGC
TGCGCTGGCCCTCCAGGAGCAGTGGCTGCAGGCCGGCAACGGCAGAAGCACGGGCGTCCT
CGACACGTCCAGACTGACTTCCTTCATTGAGCGGCGCAAACACCAGAATGATGTTCGACC
TATCCGTAGCATTAAAAACTTTCTGCAGAGCAGGCTTCTGCCTAGAGTTTGACCTATCCA
GAAGTTCTTTCTCATTCTCTTTCACCTGCCAATCAGCTGTTAATCTGAATTTTCAAGAGA
AAACAAGCAAACATAACTGATCAGCTGCCGGTATGTTCATCGTGTGAAATTGCATTCCAA
GTGAGCTGTGCTCAGCAGTGCTTGGACACAGAGCTGCAAGCTGCGCTGGGGTGGAGGACC
GTCACTTACACTCTGCCCAAGGCAGAGGTCGCATTGCTGTATCACAGTATTTTATTCAGG
TTTCTGCAAAAAAATAAAAAGATAACTTTTTTAAACAAACATGAATAGAATTTTGCAAAT
TTAACGTTTTCAAGATTTATTCAAGGAAACAAAATGCCTATGTTCAACCACTGGTGTTAA
TGAACAAAGATACTGTGCGTCTCTGGGGAAGACGCACCTAGGTGGCGGCCACTCCCATGG
CCTTGTCTAGGACTCAGAGACCACTCGGCTCTGAGCTTCCAGGCGCCTCGTCTGTGTGCA
TCTCACGCCCGACGTGGCTTCTGAAACGTGCATTCAACCTCAAACTTTTGCATAAAATAG
AATGAATCGTTTTGCTCTGATGAAATGTAGGCCTTACTTGTATATAAGACTGTTCCTGCC
TTCGGTCTGTCATTTTCCCACCTGCCTCCCCTACCCACCCCCCACCCACCACCTGGGGCT
TCCTCTGGGGGTCCGAGGGTCTTCCCATCACATGAAGACATCAGGTTGGGTCCTGCCCCA
CTGCCCCTCCCCCTGTTCCTGCCCCAAGCCGTCAATCAGATTGTGGAGCAGTACACAGTC
AGATGAAAATACTGTAAATGCACTCATTGGGGGTTTTTTGGTTTTACTTCATATCATGTG
CAATGTTGTGGCTTTAACATTTTATGCAACTATTTATGAAGACCTCTGTTGTACCTGTAA
TAAATATATAGAAAAAGCACATACTTCGTATGGTGAGCTTTATGGTTTTGTGTGTGTGTT
GGGGTTGGCGGGTGGGTGGGTAGGGTCGTAGCCCTGTGCCATCGGTTCAAAGAGACTTTT
CGTGAAATTTGTTGGTTTTGAGGACTGTAAAAGTGATTTCATACTCTGAATATAAAACTG
GATAATAGGGTAATGTTTTAAAATTTATTATGCTATTATTCAGAATGCCAAAGTATTATT
TTTTTTCCCAAAATCAGTCTGGACATTTACTACTTTTTAGACTTTTTGACGTTGAACTTT
CTGTATAAAAATTGGCTGGGTTTTGAGCTTTTGGTAAGAAATAAAAGCCGATTAAGCACT
GGCCGCCCCGCGGCTGGTACCCAATGCCCGAGTCACTGTGGCAGCATTCGCACTGGTGTG
GGGAGTCCTTTCAACTCAAGGAGGCTGGGTTTCTGGGCACCCTCGAAGTTTTCTGGATGT
CTTTTTATCTTTCTCGTGTGAACTGCACTACAAAAGAGACCAGCCCGCTTCCCAAGCCAG
CCAGACACCTGGGTCTTGAGCCATAAACTGGCGTAGTTAAGCTTTGCAGCTTCCAGTGTA
TTTTATTTATTCTTTTGTTGGGTTTTTGTTTGTTTCTTCTTGTAAAATTGTACAGAAACT
TTTTAAAAGAAATTGGATTCGAAACTGGATGTGTATTCGTAACCTCATAATTTTTATTTG
TGTATTGTTTCTTTTATTATTTCAGTTAAATTTTTACATTATTTTGCATGTATATTTCTT
TGTACAGAGACCTTACATGTTTACACAGTATGATGTGATGTAAATATTTTATTTTGCCAT
CAGTTATTTTAAAAAATTAAACATATTTGCCTGA

Protein Sequence

>7204 : length: 3097
MSGSSGGAAAPAASSGPAAAASAAGSGCGGGAGEGAEEAAKDLADIAAFFRSGFRKNDEM
KAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLISYLACIPSEEVC
KRGFTVIVDMRGSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFGSSKFEFE
TNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEDYISNATHMLSRLEELQDI
LAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLDLEGQKLLQRIQSSESFPKKNSGSG
NADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWITHNK
GLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLVESGHYASQQIR
QIASQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEVDLPSELQDL
EDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLDV
IHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSL
HRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFV
RRVEQRKILLDMSVSFHTHVKELWTWLEELQKELLDDVYAESVEAVQDLIKRFGQQQQTT
LQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERKI
KLELFLQLRIFERDAIDIISDLESWNDELSQQMNDFDTEDLTIAEQRLQHHADKALTMNN
LTFDVIHQGQDLLQYVNEVQASGVELLCDRDVDMATRVQDLLEFLHEKQQELDLAAEQHR
KHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKT
HQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTS
EQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRN
ADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQY
VVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLLI
QLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGISSDSNKSSKSLQ
LDIIPASIPGSEVKLRDAAHELNEEKRKSARRKEFIMAELIQTEKAYVRDLRECMDTYLW
EMTSGVEEIPPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCFVTWADKF
QMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELL
TCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFDENIESQGELILQESFQVWDPKTL
IRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFALWVG
RTPTSDNKIVLKASSIENKQDWIKHIREVIQERTIHLKGALKEPIHIPKTAPATRQKGRR
DGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSNELTIRRG
QTVEVLERPHDKPDWCLVRTTDRSPAAEGLVPCGSLCIAHSRSSMEMEGIFNHKDSLSVS
SNDASPPASVASLQPHMIGAQSSPGPKRPGNTLRKWLTSPVRRLSSGKADGHVKKLAHKH
KKSREVRKSADAGSQKDSDDSAATPQDETVEERGRNEGLSSGTLSKSSSSGMQSCGEEEG
EEGADAVPLPPPMAIQQHSLLQPDSQDDKASSRLLVRPTSSETPSAAELVSAIEELVKSK
MALEDRPSSLLVDQGDSSSPSFNPSDNSLLSSSSPIDEMEERKSSSLKRRHYVLQELVET
ERDYVRDLGYVVEGYMALMKEDGVPDDMKGKDKIVFGNIHQIYDWHRDFFLGELEKCLED
PEKLGSLFVKHERRLHMYIAYCQNKPKSEHIVSEYIDTFFEDLKQRLGHRLQLTDLLIKP
VQRIMKYQLLLKDFLKYSKKASLDTSELERAVEVMCIVPRRCNDMMNVGRLQGFDGKIVA
QGKLLLQDTFLVTDQDAGLLPRCRERRIFLFEQIVIFSEPLDKKKGFSMPGFLFKNSIKV
SCLCLEENVENDPCKFALTSRTGDVVETFILHSSSPSVRQTWIHEINQILENQRNFLNAL
TSPIEYQRNHSGGGGGGGSGGSGGGGGSGGGGAPSGGSGHSGGPSSCGGAPSTSRSRPSR
IPQPVRHHPPVLVSSAASSQAEADKMSGTSTPGPSLPPPGAAPEAGPSAPSRRPPGADAE
GSEREAEPIPKMKVLESPRKGAANASGSSPDAPAKDARASLGTLPLGKPRAGAASPLNSP
LSSAVPSLGKEPFPPSSPLQKGGSFWSSIPASPASRPGSFTFPGDSDSLQRQTPRHAAPG
KDTDRMSTCSSASEQSVQSTQSNGSESSSSSNISTMLVTHDYTAVKEDEINVYQGEVVQI
LASNQQNMFLVFRAATDQCPAAEGWIPGFVLGHTSAVIVENPDGTLKKSTSWHTALRLRK
KSEKKDKDGKREGKLENGYRKSREGLSNKVSVKLLNPNYIYDVPPEFVIPLSEVTCETGE
TVVLRCRVCGRPKASITWKGPEHNTLNNDGHYSISYSDLGEATLKIVGVTTEDDGIYTCI
AVNDMGSASSSASLRVLGPGMDGIMVTWKDNFDSFYSEVAELGRGRFSVVKKCDQKGTKR
AVATKFVNKKLMKRDQVTHELGILQSLQHPLLVGLLDTFETPTSYILVLEMADQGRLLDC
VVRWGSLTEGKIRAHLGEVLEAVRYLHNCRIAHLDLKPENILVDESLAKPTIKLADFGDA
VQLNTTYYIHQLLGNPEFAAPEIILGNPVSLTSDTWSVGVLTYVLLSGVSPFLDDSVEET
CLNICRLDFSFPDDYFKGVSQKAKEFVCFLLQEDPAKRPSAALALQEQWLQAGNGRSTGV
LDTSRLTSFIERRKHQNDVRPIRSIKNFLQSRLLPRV