ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7189

Name

TRAF6

Synonym

MGC:3310|RNF85;TNF receptor-associated factor 6, E3 ubiquitin protein ligase;TRAF6;TNF receptor-associated factor 6, E3 ubiquitin protein ligase

Definition

E3 ubiquitin-protein ligase TRAF6|RING finger protein 85|TNF receptor-associated factor 6|interleukin-1 signal transducer

Position

11p12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

p75(NTR)-mediated signaling;PID Curated;200103

Pathway

Regulation of p38-alpha and p38-beta;PID Curated;200054

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

RIG-I-like receptor signaling pathway;KEGG PATHWAY;hsa04622

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

p75NTR signals via NF-kB;PID Reactome;500613

Pathway

p75NTR recruits signalling complexes;PID Reactome;500614

Pathway

Toll receptor signaling pathway;PANTHER;P00054

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

NF-kB is activated and signals survival;PID Reactome;500615

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120

Pathway

NRIF signals cell death from the nucleus;PID Reactome;500610

Pathway

CD40/CD40L signaling;PID Curated;200031

Pathway

nf-kb signaling pathway;PID BioCarta;100097

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

TCR signaling in naive CD4+ T cells;PID Curated;200022

Pathway

Regulated proteolysis of p75NTR;PID Reactome;500620

Pathway

signal transduction through il1r;PID BioCarta;100132

Pathway

yaci and bcma stimulation of b cell immune responses;PID BioCarta;100024

Pathway

Downstream TCR signaling;PID Reactome;500482

Pathway

toll-like receptor pathway;PID BioCarta;100013

Pathway

cd40l signaling pathway;PID BioCarta;100213

Pathway

TRAF6 Mediated Induction of the antiviral cytokine IFN-alpha/beta cascade;PID Reactome;500449

Pathway

MyD88 cascade;PID Reactome;500445

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

IL1-mediated signaling events;PID Curated;200075

Pathway

bone remodeling;PID BioCarta;100052

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

p38 MAPK signaling pathway;PID Curated;200014

Pathway

Interleukin-1 signaling;PID Reactome;500490

Pathway

TCR signaling in naive CD8+ T cells;PID Curated;200062

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Pathway

Canonical NF-kappaB pathway;PID Curated;200026

Disease

Ectodermal dysplasia;FunDO

Disease

Osteoporosis;FunDO

Disease

Infection;FunDO

External Links

Links to cell senescence gene database

7189

Links to epithelial mesenchymal transition gene database

7189

Links to ovarian cancer gene database

7189

Links to endometrial cancer gene database

7189

Links to iHOP

7189

Sequence Information

Nucleotide Sequence

>7189 : length: 8040
CTCCTCCCCGGCGCGCTCCCTGCCCCTCGCTCCCCGCAGCCAGCAGAGAAGGCGGAAGCA
GTGGCGTCCGCAGCTGGGGCTTGGCCTGCGGGCGGCCAGCGAAGGTGGCGAAGGCTCCCA
CTGGATCCAGAGTTTGCCGTCCAAGCAGCCTCGTCTCGGCGCGCAGTGTCTGTGTCCGTC
CTCTACCAGCGCCTTGGCTGAGCGGAGTCGTGCGGTTGGTGGGGGAGCCCTGCCCTCCTG
GTTCGGCCTCCCCGCGCACTAGAACGATCATGAACTTCTGAAGGGACCCAGCTTTCTTTG
TGTGCTCCAAGTGATTTGCACAAATAATAATATATATATTTATTGAAGGAGAGAATCAGA
GCAAGTGATAATCAAGTTACTATGAGTCTGCTAAACTGTGAAAACAGCTGTGGATCCAGC
CAGTCTGAAAGTGACTGCTGTGTGGCCATGGCCAGCTCCTGTAGCGCTGTAACAAAAGAT
GATAGTGTGGGTGGAACTGCCAGCACGGGGAACCTCTCCAGCTCATTTATGGAGGAGATC
CAGGGATATGATGTAGAGTTTGACCCACCCCTGGAAAGCAAGTATGAATGCCCCATCTGC
TTGATGGCATTACGAGAAGCAGTGCAAACGCCATGCGGCCATAGGTTCTGCAAAGCCTGC
ATCATAAAATCAATAAGGGATGCAGGTCACAAATGTCCAGTTGACAATGAAATACTGCTG
GAAAATCAACTATTTCCAGACAATTTTGCAAAACGTGAGATTCTTTCTCTGATGGTGAAA
TGTCCAAATGAAGGTTGTTTGCACAAGATGGAACTGAGACATCTTGAGGATCATCAAGCA
CATTGTGAGTTTGCTCTTATGGATTGTCCCCAATGCCAGCGTCCCTTCCAAAAATTCCAT
ATTAATATTCACATTCTGAAGGATTGTCCAAGGAGACAGGTTTCTTGTGACAACTGTGCT
GCATCAATGGCATTTGAAGATAAAGAGATCCATGACCAGAACTGTCCTTTGGCAAATGTC
ATCTGTGAATACTGCAATACTATACTCATCAGAGAACAGATGCCTAATCATTATGATCTA
GACTGCCCTACAGCCCCAATTCCATGCACATTCAGTACTTTTGGTTGCCATGAAAAGATG
CAGAGGAATCACTTGGCACGCCACCTACAAGAGAACACCCAGTCACACATGAGAATGTTG
GCCCAGGCTGTTCATAGTTTGAGCGTTATACCCGACTCTGGGTATATCTCAGAGGTCCGG
AATTTCCAGGAAACTATTCACCAGTTAGAGGGTCGCCTTGTAAGACAAGACCATCAAATC
CGGGAGCTGACTGCTAAAATGGAAACTCAGAGTATGTATGTAAGTGAGCTCAAACGAACC
ATTCGAACCCTTGAGGACAAAGTTGCTGAAATCGAAGCACAGCAGTGCAATGGAATTTAT
ATTTGGAAGATTGGCAACTTTGGAATGCATTTGAAATGTCAAGAAGAGGAGAAACCTGTT
GTGATTCATAGCCCTGGATTCTACACTGGCAAACCCGGGTACAAACTGTGCATGCGCTTG
CACCTTCAGTTACCGACTGCTCAGCGCTGTGCAAACTATATATCCCTTTTTGTCCACACA
ATGCAAGGAGAATATGACAGCCACCTCCCTTGGCCCTTCCAGGGTACAATACGCCTTACA
ATTCTTGATCAGTCTGAAGCACCTGTAAGGCAAAACCACGAAGAGATAATGGATGCCAAA
CCAGAGCTGCTTGCTTTCCAGCGACCCACAATCCCACGGAACCCAAAAGGTTTTGGCTAT
GTAACTTTTATGCATCTGGAAGCCCTAAGACAAAGAACTTTCATTAAGGATGACACATTA
TTAGTGCGCTGTGAGGTCTCCACCCGCTTTGACATGGGTAGCCTTCGGAGGGAGGGTTTT
CAGCCACGAAGTACTGATGCAGGGGTATAGCTTGCCCTCACTTGCTCAAAAACAACTACC
TGGAGAAAACAGTGCCTTTCCTTGCCCTGTTCTCAATAACATGCAAACAAACAAGCCACG
GGAAATATGTAATATCTACTAGTGAGTGTTGTTAGAGAGGTCACTTACTATTTCTTCCTG
TTACAAATGATCTGAGGCAGTTTTTTCCTGGGAATCCACACGTTCCATGCTTTTTCAGAA
ATGTTAGGCCTGAAGTGCCTGTGGCATGTTGCAGCAGCTATTTTGCCAGTTAGTATACCT
CTTTGTTGTACTTTCTTGGGCTTTTGCTCTGGTGTATTTTATTGTCAGAAAGTCCAGACT
CAAGAGTACTAAACTTTTAATAATAATGGATTTTCCTTAAAACTTCAGTCTTTTTGTAGT
ATTATATGTAATATATTAAAAGTGAAAATCACTACCGCCTTGTGCTAGTGCCCTCGAGAA
GAGTTATTGCTCTAGAAAGTTGAGTTCTCATTTTTTTAACCTGTTATAGATTTCAGAGGA
TTTGAACCATAATCCTTGGAAAACTTAAGTTCTCATTCACCCCAGTTTTTCCTCCAGGTT
GTTACTAAGGATATTCAGGGATGAGTTTAAACCCTAAATATAACCTTAATTATTTAGTGT
AAACATGTCTGTTGAATAATACTTGTTTAAGTGTTCCTTCTGCCTTGCTTACTTATTTCC
TTGAGGTTACGAAGTAGCATCTTCCCCAGAGTTTATAATGCTGAGAACCACGTGGATACC
AACTGCTCATTGTTATGCTATGTAACCCTTTTTGTCTATTCAGTGCAGAGTGAATTTCAC
AGCTCTGCATATGTCTTCATTTGTTTAATGCTTACAAGACAGGAGATGCACACATACAAT
CAGCAACATAAAAATTAAAAGTGACCCAAGTAGTCAGCGCATGTGGCATCTCATTGGTGG
TGACAGAAGCTATGTGAGCCAGAAGTTTTCAGCTCTTTTGAATACCCTCTGGTTTATTTC
GATTAAAAAGAACAAAATTGATTTCCTAAAATCAGAATTTTTTAAAACTTGGGAGATGAT
TGGAGATACCTAGGAGGTCACCAAACTAGGATTAGAAGTCACAGTGGTTGTATCACAACT
TAGCTTGAGTATGTTGCTGTAGCCTAACAACTGCAGGTTCTGAGAAGGATCCTGTAGAAT
CCTGGAAGTAACCAGATTTTCCTAATAGGGAGATGATTTTTTTGTGTGCCATCATGTATT
TGTTAAAGGCCTATATATAGATATAAAATATCGTGGAATCTAGTTCTCAGGGAGACCCGC
AACTAGTATAAGCTTATAAAGGATCTAAAGATCCATCCACCATTTAAAGTTGTCTGGTAA
TGAGAGATGACATTGTATCCCCCAGAGAGGCCAAATCAGAGTCGCCAGCCAGCGTTCTAG
ATCAGCCTTAATTTCAAGAGAAAGCCAAGGACCTCATCTGCAGGGGAGTGTGGTTTTCAG
CCCCAGCGAGTGTCACTTTGAACTTTCCCTTTGCTTTTTTCTCTCTTCTCCCTCCCCACC
CACCCTTAGGCTCCTGATCTGGTGAGTTTGTTATGGAGTGAAAATAAAAGTCAAGCAGAG
ACCTTGTTTCCCGTGCCACCATTAGTACCACAAGCTCATGGCTAGTTACCACATTACTTC
CTGGCAGTTTGTGTCCCTCAGCTGTGCCTTCCAACCAGCGCCTGAGAATCACTGCATACC
ACCCTCTAGGTAGGGAAACCTACACTGCTGCTGTTCCTGTGATTATTTTACAATGAATAA
ATAATTGTCAAGTTCCATTTAAAAACTGAACAGTAGTATTTTTGTATTTGCGTAGAAAAA
GCCTGAAGGAAATATACTAAACTTTTTGTTGGCTTATTTTCCTTTGCGCTTGCTTATATT
TTTTACATTTTCTACAATAAATGTGTACTTTTATCGGAGAAAAAAATTAAATGTTGCCAC
AAAACATTTAATCTCCACGCCCCCAGCTCAAAAAAGGAAATGATATTTAAAAGCTTCCTG
GTCAGATTTCTATTAAAAGCACTGGCTGTGCATTAGATACAAAGAGGAGTCATTTCCTGC
CTTGGTGATACTATTTTTTTCTACTAACTCAAGAGTCTTTATTAAAAAAAAAAGTTGTTT
TGCCTAATTTCAGCTTTTAGCAAGCTTCCCATCTGTAAAATGATTTGGACCAGATATTTC
TAGAGTCCCCTCCAGCCATAACATTCTGTCTCAAATTAAGTTCCAACCAGCAGAACAATG
ACAATACTTAGGAAAGTATTTTGCCAGTATAAAATGTCTTTAACTTACTCTTTGCTGACA
CTGATACTTTCCTCTAATTTAGTGTCTATCAGCTGGGTCACATCTTAAGTAAAATGAGCA
ATTTTAACCCCCAACATTTGGCATTTTGTCATAAACCAGCCAGTTATTTTATGCTGGTCA
TTCATCTTGACTACAAAGTAGAATAGTCAAGCTGTCATTCCAAATAGAAAACTTTTTACT
TCAATCAGAATTAAGCCTTAACCTGGAAAGTTGGTTTCTTCCTTACATTTTCCCAATCTC
CTACTCTATTCTTAAACATGCTAGTTTCACTCAGTTGGGTATACAAGCCTTTGGGCTTTA
TGTTGTATGTTACTAACCACCTTTTACCATATTTATCTTTTGGCATCATTCTGGGACATT
GCTAAATTAAAAAAGAAATTGTTTCCACTTTTTTCTGGAGATGTTCAACTAAAGGTTGTT
TTGTTTTGTTTTTTGTTTTGAGACAGTCTCACCCTGACGCTCAGGCTGGAGTGCAGTGGT
GCAACCTCGGCTCACTGCAACCTCCACCTCCCGGGCTCAAGCCATTCTCCTGCCTCAGCC
TCCCAAGCAGCTGGGATTACAGGCACCCGCCACCACGCCCAGCTAATTTTTTTGTATTTT
GAGTAGAGACCGGGTTTCACCATATTGGCCAGTCTCGTCTGGAACTCCTGACCTCAGATG
ATCCGCCCGCCTCAGCCTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCACGCCCAGC
GTCCAACCCACTGTTGGATGAAACTTGCTGCACGTCATACATTTTGCTGTTGGCAAACAA
GTCTGAATGTTGATTTGAAGTTTGGTAGTTTATTACTATCTATTGGCAGCAAAGACTGTT
TATTGGTATACTACAATATGATTTAACTTTTATTTTGGGGATAAATAGTAGAAAAAAGTG
AAACAGAATGAAGGCAGGTGTTTTTTATTCTAATGATGGAATAATACAGAGATACTGGAC
GATCTCTAGCAGTTAATTATTGTGACCCATATAAAATTATACAGGTCACAGTATAATTCT
CTATTACCGTTTTTACACCAGTAAGTCTTAGATAAACTAAGCATGCTTATGAATTATGTA
TACAGTTAGAATGCATTATTTTTACAGAGGAACAATTGCTTGTATGTACTAACACTGTTC
TCTTGGCTTGCCTCAAGTTCTACTCATTATTTTATATAAAATACTATTAGGCTGGGCACG
GTGGCTCACGCCTATAATCCCAGCACTTTGGGAGGTGGAGGCTGGCGGATTACTTGAAGC
CAGGAGTTCGAGACCAGCCTGGCCAAAATGGTGAAACCCCATCTCTATAAAAATACAAAA
ATTAGCCAGGTGTCATGATACATGCCTGTAATCCCAGCTTCTTGGGAGGCTGAGGCACGG
GAATCGCTTGAACCCGGGAAGCACAGGTTGCAGTGAGCCAAGATCATGCCACTGCACCCC
CAGCCTGGGTGACAGAGTGCAACACTGTCTCACAAAACAAAACAAAAACATCAGATTCTG
TTTGTGATGCCTAGTTGCTTACAACCTAAACAGTGCAATGCCTTAAGGAAATGAAAAGGA
GCCATAAGTAGTCATTTATATTTTTATTTTGAAGTGTGCTTTTTCTAAACTCCCAGATTG
ACATGATGGACTGTAAGTTAGTTTCTCTGTTTCTGTCTTTGTGCCTGTAGAGTGTACTTG
GCACTTACAAATTCCCAGTATCCAGAAAGATGATCTGATGAAATCAAATTGGATGGATCT
TGGCAGACTGTGACACTCAATTACAGCCTTCACTTTCAGTCAAAAACGGACACTTGGCAA
GGAGGTGCCTGGTTGTTTCACTAAATGTCACTTGTGTGTGTAATATTTTAAAGCTTTTTC
CCCACAGGAAATTCGGGTCATAAAATCCTGAAAAATAATTCTAGGTGGGAAAAGCATTTT
AGGAAATGAGAGATGTGGTGCTGCTTTTCTTCTCTCAGAGTGCTTTCTCAGCAGGACACT
AGCCCTGCCTTTAAGATGGGGAAGTTGGGGCATGTGCCTCTGCTCTTACTGTCTGCAGCT
CTGAAGGTAGGTGCTGTCCCACTCGGACAATCGCCCAAGCAGCAGTGACCATAGTTCTCT
TCTATGCAAGTCCCCAGGAGAAGGTAAACTGTGTGGAATGGGGATGTGTTCTGGTTGCTG
CTGAATCCCCTCTTCTTACCACAGTGCCTGGCACGTTGCACACACTCAAATACGTAATAA
TGAACATTTATTGAAAGCAGCAGTTGAAGCTGACCAATTTCTGGTACCTTGTCATGTAAA
TTTTAGATGGTAAGGCGCAGATGTTACTTTTTTTGCTTTTTTTCTTCAGCACTTGATGAA
ATTTCCCAAACATGCAGAAATGTTGAAAGACTTGTATAGTGAACATCTACGACCTAGAAT
CTGCAGTAATATTATGTTACATTTGCTTTATCACTTGATAGATGTTACTTTTAATGAGAC
TTCAAGTTTGGTTTCTCTAAACAAAATATTCTAAAATAACTGAACAACTTTAATCAATTT
GTCTTAAGTTCTTTGGGGGAACTTGGGACATTTGCTTTGTAACTGGAATTGCAGCCCTCA
CGTTAAGCTAATTTTAAACTTTGCAAATTTGTTATGCTGAATTTCAGTCTTATTTATTTT
GCCTGAAGGGGTATTTTTTGTAATGGATTTATTTGAAGGTCCTTGATAAATTGTGCAGAA
TATTCTCGTGTTCTTTTTGCACTTGATAAATTATCTAATTTCTGTGGTGAGAATGTAATT
TGGGGCCTATTTTGTTTATACAAGCTTCCAGAATTATGTTCTCAGAGGGATGAAAAGGTG
TAATTTAGCATATAGGTCACTAAATTAGGAGCTAAGACACATTTTCTCCTGACTGACCAT
GGGTCAATCAGTTTTGTCTTCGTGTCCTTTTCCTTGTAAAGTAGAAACTAGAATTTGAAA
TTTAAATATTAAATAATGGGTAACATTCATTAATGTATGACTCTATTAAGAAAGACACTG
TGAATCCAGGGAGGATTCTCATAATTCTGTAAACTGTATGACAAGCTGTGGAATGAAATC
TGACTTTTGAAAATTGAAAGACATCCAGTGGTCTTATCACAAAGCCTGCTTTTCCTCAGA
ACTTAACTATTGCCATGGAATTTGTAAGCAGTTATCCTAATCCATCTGGACTCTGAAAAT
GCATCCTTTATGAGAGGGAGTGAATGCAAAGATAAGGGTGGGGAAACACTAATCATGAAA
AGAATGAAAATCAGTGTTCAGTTTTAAGAGCAGGTTGTATTGAAGGAAGGGATTAAAGGA
ATTATCCAGATTTGAGGTGGCACATCTTCCACCACTCCCTGCACCATCAGCATGCACGGA
GCGCATAAAACAAGCCCTGCTCCTAATGGCAGTGAAACCTCGGATGGCCTCCATCAGGTC
AATACAACTGAATTGCTGGGCTGACTTAAGATTGAAGGACTCCATTTTAGTAAGTAGAGA
AGTGTGACCTTTCTCAACCCAGGTTGTGAATGTGGATTCACACTTATCTCAAAAAGGCAC
CTGGAGTTTTAACTTTATGTCATGTCTCAGTACTGGTTGCAAGGTATGACCAAAAGTGTT
CCTTGAATGGCACCTTTTTGAATATTAATTTAGAAGAAAACATGCCAGACTGACATACTT
ACCCCCTCCGCACTGTTACTACTTCCTTACCAGCCCTATGTACTGCATCAATGTCTACAA
GAAAGCACTCTTCATTAAAATGAAATATATATATTAAAATAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>7189 : length: 522
MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILK
DCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV