ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7175

Name

TPR

Synonym

translocated promoter region, nuclear basket protein;TPR;translocated promoter region, nuclear basket protein

Definition

NPC-associated intranuclear protein|megator|nuclear pore complex-associated protein TPR|nucleoprotein TPR|translocated promoter region (to activated MET oncogene)|translocated promoter region protein|tumor potentiating region

Position

1q25

Gene Type

protein-coding

Pathways and Diseases

Pathway

Metabolism of carbohydrates;Reactome;REACT:474

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Transmembrane transport of small molecules;Reactome;REACT:15518

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Pathway

HIV Infection;Reactome;REACT:6185

Disease

Thyroid cancer;KEGG DISEASE;H00032

Disease

Cancers;KEGG DISEASE

Disease

Cancers of endocrine organs;KEGG DISEASE

External Links

Links to cell senescence gene database

7175

Links to epithelial mesenchymal transition gene database

7175

Links to ovarian cancer gene database

7175

Links to endometrial cancer gene database

7175

Links to iHOP

7175

Sequence Information

Nucleotide Sequence

>7175 : length: 9727
GCGCAAGAGGATCAGGGATAGCCTCTGAGCTCGGGTTCCCAGGGTTCGTAGCTTCCAACG
GCTGCGCGCGCACTTCGGTCGCGGGCGGTGAGGTGCTGTTGCTGAAACGCTGCCGCTGAG
GGTGGACTCGATTTCCCAGGGTCCCGCCGCGGGAGTCTCCGGCGGGCGGGCGCGCGCGAG
CCACCGAGCGAGGTGATAGAGGCGGCGGCCCAGGCGTCTGGGTCCTGCTGGTCTTCGCCT
TTCTTCTCCGCTTCTACCCCGTCGGCCGCTGCCACTGGGGTCCCTGGCCCCACCGACATG
GCGGCGGTGTTGCAGCAAGTCCTGGAGCGCACGGAGCTGAACAAGCTGCCCAAGTCTGTC
CAGAACAAACTTGAAAAGTTCCTTGCTGATCAGCAATCCGAGATCGATGGCCTGAAGGGG
CGGCATGAGAAATTTAAGGTGGAGAGCGAACAACAGTATTTTGAAATAGAAAAGAGGTTG
TCCCACAGTCAGGAGAGACTTGTGAATGAAACCCGAGAGTGTCAAAGCTTGCGGCTTGAG
CTAGAGAAACTCAACAATCAACTGAAGGCACTAACTGAGAAAAACAAAGAACTTGAAATT
GCTCAGGATCGCAATATTGCCATTCAGAGCCAATTTACAAGAACAAAGGAAGAATTAGAA
GCTGAGAAAAGAGACTTAATTAGAACCAATGAGAGACTATCTCAAGAACTTGAATACTTA
ACAGAGGATGTTAAACGTCTGAATGAAAAACTTAAAGAAAGCAATACAACAAAGGGTGAA
CTTCAGTTAAAATTGGATGAACTTCAAGCTTCTGATGTTTCTGTTAAGTATCGAGAAAAA
CGCTTGGAGCAAGAAAAGGAATTGCTACATAGTCAGAATACATGGCTGAATACAGAGTTG
AAAACCAAAACTGATGAACTTCTGGCTCTTGGAAGAGAAAAAGGGAATGAGATTCTAGAG
CTTAAATGTAATCTTGAAAATAAAAAAGAAGAGGTTTCTAGACTGGAAGAACAAATGAAT
GGCTTAAAAACATCAAATGAACATCTTCAAAAGCATGTGGAGGATCTGTTGACCAAATTA
AAAGAGGCCAAGGAACAACAGGCCAGTATGGAAGAGAAATTCCACAATGAATTAAATGCC
CACATAAAACTTTCTAATTTGTACAAGAGTGCCGCTGATGACTCAGAAGCAAAGAGCAAT
GAACTAACCCGGGCAGTAGAGGAACTACACAAACTTTTGAAAGAAGCTGGTGAAGCCAAC
AAAGCAATACAAGATCATCTTCTAGAGGTGGAGCAATCCAAAGATCAAATGGAAAAAGAA
ATGCTTGAGAAAATAGGGAGATTGGAGAAGGAATTAGAGAATGCAAATGACCTTCTTTCT
GCCACAAAACGTAAAGGAGCCATATTGTCTGAAGAAGAGCTTGCCGCCATGTCTCCTACT
GCAGCAGCTGTAGCTAAGATAGTGAAACCTGGGATGAAACTAACTGAGCTCTATAATGCT
TATGTGGAAACTCAGGATCAGTTGCTTTTGGAGAAACTAGAGAACAAAAGAATTAATAAG
TACCTAGATGAAATAGTGAAAGAAGTGGAAGCCAAAGCACCAATTTTGAAACGCCAGCGT
GAGGAATATGAACGTGCACAGAAAGCTGTAGCAAGTTTATCTGTTAAGCTTGAACAAGCT
ATGAAGGAGATTCAGCGATTGCAGGAGGACACTGATAAAGCCAACAAGCAATCATCTGTA
CTTGAGAGAGATAATCGAAGAATGGAAATACAAGTAAAAGATCTTTCACAACAGATTAGA
GTGCTTTTGATGGAACTTGAAGAAGCAAGGGGTAACCACGTAATTCGTGATGAGGAAGTA
AGCTCTGCTGATATAAGTAGTTCATCTGAGGTAATATCACAGCATCTAGTATCTTACAGA
AATATTGAAGAGCTTCAACAACAAAATCAACGTCTCTTAGTGGCCCTTAGAGAGCTTGGG
GAAACCAGAGAAAGAGAAGAACAAGAAACAACTTCATCCAAAATCACTGAGCTTCAGCTC
AAACTTGAGAGTGCCCTTACTGAACTAGAACAACTCCGCAAATCACGACAGCATCAAATG
CAGCTTGTTGATTCCATAGTTCGTCAGCGTGATATGTACCGTATTTTATTGTCACAAACA
ACAGGAGTTGCCATTCCATTACATGCTTCAAGCTTAGATGATGTTTCTCTTGCATCAACT
CCAAAACGTCCAAGTACATCACAGACTGTTTCCACTCCTGCTCCAGTACCTGTTATTGAA
TCAACAGAGGCTATAGAGGCTAAGGCTGCCCTTAAACAGTTGCAGGAAATTTTTGAGAAC
TACAAAAAAGAAAAAGCAGAAAATGAAAAAATACAAAATGAGCAGCTTGAGAAACTTCAA
GAACAAGTTACAGATTTGCGATCACAAAATACCAAAATTTCTACCCAGCTAGATTTTGCT
TCTAAACGTTATGAAATGCTGCAAGATAATGTTGAAGGATATCGTCGAGAAATAACATCA
CTTCATGAGAGAAATCAGAAACTCACTGCCACAACTCAAAAGCAAGAACAGATTATCAAT
ACGATGACTCAAGATTTGAGAGGAGCAAATGAGAAGCTAGCTGTCGCAGAAGTAAGAGCA
GAAAATTTGAAGAAGGAAAAGGAAATGCTTAAATTGTCTGAAGTTCGTCTTTCTCAGCAA
AGAGAGTCTTTGTTAGCTGAACAAAGGGGGCAAAACTTACTGCTAACTAATCTGCAAACA
ATTCAGGGAATACTGGAGCGATCTGAAACAGAAACCAAACAAAGGCTTAGTAGCCAGATA
GAAAAACTGGAACATGAGATCTCTCATCTAAAGAAGAAGTTGGAAAATGAGGTGGAACAA
AGGCATACACTTACTAGAAATCTAGATGTTCAACTTTTAGATACAAAGAGACAACTGGAT
ACAGAGACAAATCTTCATCTTAACACAAAAGAACTATTAAAAAATGCTCAAAAAGAAATT
GCCACATTGAAACAGCACCTCAGTAATATGGAAGTCCAAGTTGCTTCTCAGTCTTCACAG
AGAACTGGTAAAGGTCAGCCTAGCAACAAAGAAGATGTGGATGATCTTGTGAGTCAGCTA
AGACAGACAGAAGAGCAGGTGAATGACTTAAAGGAGAGACTCAAAACAAGTACGAGCAAT
GTGGAACAATATCAAGCAATGGTTACTAGTTTAGAAGAATCCCTGAACAAGGAAAAACAG
GTGACAGAAGAAGTGCGTAAGAATATTGAAGTTCGTTTAAAAGAGTCAGCTGAATTTCAG
ACACAGTTGGAAAAGAAGTTGATGGAAGTAGAGAAGGAAAAACAAGAACTTCAGGATGAT
AAAAGAAGAGCCATAGAGAGCATGGAACAACAGTTATCTGAATTGAAGAAAACACTTTCT
AGTGTTCAGAATGAAGTACAAGAAGCTCTTCAGAGAGCAAGCACAGCTTTAAGTAATGAG
CAGCAAGCCAGACGTGACTGTCAGGAACAAGCTAAAATAGCTGTGGAAGCTCAGAATAAG
TATGAGAGAGAATTGATGCTGCATGCTGCTGATGTTGAAGCTCTACAAGCTGCGAAGGAG
CAGGTTTCAAAAATGGCATCAGTCCGTCAGCATTTGGAAGAAACAACACAGAAAGCAGAA
TCACAGTTGTTGGAGTGTAAAGCATCTTGGGAGGAAAGAGAGAGAATGTTAAAGGATGAA
GTTTCCAAATGTGTATGTCGCTGTGAAGATCTGGAGAAACAAAACAGATTACTTCATGAT
CAGATCGAAAAATTAAGTGACAAGGTCGTTGCCTCTGTGAAGGAAGGTGTACAAGGTCCA
CTGAATGTATCTCTCAGTGAAGAAGGAAAATCTCAAGAACAAATTTTGGAAATTCTCAGA
TTTATACGACGAGAAAAAGAAATTGCTGAAACTAGGTTTGAGGTGGCTCAGGTTGAGAGT
CTGCGTTATCGACAAAGGGTTGAACTTTTAGAAAGAGAGCTGCAGGAACTGCAAGATAGT
CTAAATGCTGAAAGGGAGAAAGTCCAGGTAACTGCAAAAACAATGGCTCAGCATGAAGAA
CTGATGAAGAAAACTGAAACAATGAATGTAGTTATGGAGACCAATAAAATGCTAAGAGAA
GAGAAGGAGAGACTAGAACAGGATCTACAGCAAATGCAAGCAAAGGTGAGGAAACTGGAG
TTAGATATTTTACCCTTACAAGAAGCAAATGCTGAGCTGAGTGAGAAAAGCGGTATGTTG
CAGGCAGAGAAGAAGCTCTTAGAAGAGGATGTCAAACGTTGGAAAGCACGTAACCAGCAT
CTAGTAAGTCAACAGAAAGATCCAGATACAGAAGAATATCGGAAGCTCCTTTCTGAAAAG
GAAGTTCATACTAAGCGTATTCAACAATTGACAGAAGAAATTGGTAGACTTAAAGCTGAA
ATTGCAAGATCAAATGCATCTTTGACTAACAACCAGAACTTAATTCAGAGTCTGAAGGAA
GATCTAAATAAAGTAAGAACTGAAAAGGAAACCATCCAGAAGGACTTAGATGCCAAAATA
ATTGATATCCAAGAAAAAGTCAAAACTATTACTCAAGTTAAGAAAATTGGACGTAGGTAC
AAGACTCAATATGAAGAACTTAAAGCACAACAGGATAAGGTTATGGAGACATCGGCTCAG
TCCTCTGGAGACCATCAGGAGCAGCATGTTTCAGTCCAGGAAATGCAGGAACTCAAAGAA
ACGCTCAACCAAGCTGAAACAAAATCAAAATCACTTGAAAGTCAAGTAGAGAATCTGCAG
AAGACATTATCTGAAAAAGAGACAGAAGCAAGAAATCTCCAGGAACAGACTGTGCAACTT
CAGTCTGAACTTTCACGACTTCGTCAGGATCTTCAAGATAGAACCACACAGGAGGAGCAG
CTCCGACAACAGATAACTGAAAAGGAAGAAAAAACCAGAAAGGCTATTGTAGCAGCAAAG
TCAAAAATTGCACACTTAGCTGGTGTAAAAGATCAGCTAACTAAAGAAAATGAGGAGCTT
AAACAAAGGAATGGAGCCTTAGATCAGCAGAAAGATGAATTGGATGTTCGCATTACTGCG
CTAAAGTCCCAATATGAAGGTCGAATTAGTCGCTTGGAAAGAGAACTCAGGGAGCATCAA
GAGAGACACCTTGAGCAGAGAGATGAGCCTCAAGAACCTTCTAATAAGGTCCCTGAACAG
CAGAGACAGATCACATTGAAAACAACTCCAGCTTCTGGTGAAAGAGGAATTGCCAGCACA
TCAGACCCACCAACAGCCAATATCAAGCCAACTCCTGTTGTGTCTACTCCAAGTAAAGTG
ACAGCTGCAGCTATGGCTGGAAATAAGTCAACACCCAGGGCTAGTATCCGCCCAATGGTT
ACACCTGCAACTGTTACAAATCCCACTACTACCCCAACAGCTACAGTGATGCCCACTACA
CAAGTGGAATCACAGGAAGCTATGCAGTCAGAAGGGCCTGTGGAACATGTTCCAGTTTTT
GGAAGCACAAGTGGATCCGTTCGTTCTACTAGTCCTAATGTCCAGCCTTCTATCTCTCAA
CCTATTTTAACTGTTCAGCAACAAACACAGGCTACAGCTTTTGTGCAACCCACTCAACAG
AGTCATCCTCAGATTGAGCCTGCCAATCAAGAGTTATCTTCAAACATAGTAGAGGTTGTT
CAGAGTTCACCAGTTGAGCGGCCTTCTACTTCCACAGCAGTATTTGGCACAGTTTCGGCT
ACCCCCAGTTCTTCTTTGCCAAAGCGTACACGTGAAGAGGAAGAGGATAGCACCATAGAA
GCATCAGACCAAGTCTCTGATGATACAGTGGAAATGCCTCTTCCAAAGAAGTTGAAAAGT
GTCACACCTGTAGGAACTGAGGAAGAAGTTATGGCAGAAGAAAGTACTGATGGAGAGGTA
GAGACTCAGGTATACAACCAGGATTCTCAAGATTCCATTGGAGAAGGAGTTACCCAGGGA
GATTATACACCTATGGAAGACAGTGAAGAAACCTCTCAGTCTCTACAAATAGATCTTGGG
CCACTTCAATCAGATCAGCAGACGACAACTTCATCCCAGGATGGTCAAGGCAAAGGAGAT
GATGTCATTGTAATTGACAGTGATGATGAAGAAGAGGATGATGATGAAAATGATGGAGAA
CATGAGGATTATGAAGAGGATGAGGAAGATGATGATGATGATGAAGATGACACAGGGATG
GGAGATGAGGGTGAAGATAGTAATGAAGGAACTGGTAGTGCCGATGGCAATGATGGTTAT
GAAGCTGATGATGCTGAGGGTGGTGATGGGACTGATCCAGGTACAGAAACAGAAGAAAGT
ATGGGTGGAGGTGAAGGTAATCACAGAGCTGCTGATTCTCAAAACAGTGGTGAAGGAAAT
ACAGGTGCTGCAGAATCTTCTTTTTCTCAGGAGGTTTCTAGAGAACAACAGCCATCATCA
GCATCTGAAAGACAGGCCCCTCGAGCACCTCAGTCACCGAGACGCCCACCACATCCACTT
CCCCCAAGACTGACCATTCATGCCCCACCTCAGGAGTTGGGACCACCAGTTCAGAGAATT
CAGATGACCCGAAGGCAGTCTGTAGGACGTGGCCTTCAGTTGACTCCAGGAATAGGTGGC
ATGCAACAGCATTTTTTTGATGATGAAGACAGAACAGTTCCAAGTACTCCAACTCTTGTG
GTGCCACATCGTACTGATGGATTTGCTGAAGCAATTCATTCGCCGCAGGTTGCTGGTGTC
CCTAGATTCCGGTTTGGGCCACCTGAAGATATGCCACAAACAAGTTCTAGTCACTCTGAT
CTTGGCCAGCTTGCTTCTCAAGGAGGTTTAGGAATGTATGAAACACCCCTGTTCCTAGCT
CATGAAGAAGAGTCAGGTGGCCGAAGTGTTCCCACTACTCCACTACAAGTAGCAGCCCCA
GTGACTGTATTTACTGAGAGCACCACCTCTGATGCTTCGGAACATGCCTCTCAATCTGTT
CCAATGGTGACTACATCCACTGGCACTTTATCTACAACAAATGAAACAGCAACAGGTGAT
GATGGAGATGAAGTATTTGTGGAGGCAGAATCTGAAGGTATTAGTTCAGAAGCAGGCCTA
GAAATTGATAGCCAGCAGGAAGAAGAGCCGGTTCAAGCATCTGATGAGTCAGATCTCCCC
TCCACCAGCCAGGATCCTCCTTCTAGCTCATCTGTAGATACTAGTAGTAGTCAACCAAAG
CCTTTCAGACGAGTAAGACTTCAGACAACATTGAGACAAGGTGTCCGTGGTCGTCAGTTT
AACAGACAGAGAGGTGTGAGCCATGCAATGGGAGGGAGAGGAGGAATAAACAGAGGAAAT
ATTAATTAAATGGTCTGTAAACAATAACAACTGTGAATAAGATTATCAAATCTGTTTTAG
TGTAATGATTGTCAAGTTTAAAAACATTTTTATATATAAACTGGTATACTCATGTCAATA
TTCTTTATTAATAAAATGTTTTTCAGTGTCAAAATTTATTATTCATTTCTTCATTAGTTG
ACTCCTCCTTTGCTCATCAGTCTAAGGACAGTTGTACCAGACTTTGGATAAGGTCTGCCC
AGAACGAGTAGTAATTGCTCTTGCTGTTCTACTAGGCACATCAATGTTATAGTATTGATC
TAAATGGAAGAGAAAACATTTTTTTAGTTAAAAAGAAAACAATGCCCAAACTAAAAAATA
ACTTATGTTGACTATTATGCTCAAAGACAATGTTTATCATTTTAATAGAGATGTTTTTAC
TAATTAATTTGAACTTTATAACAAAAAGAAAAACAATTGCCTAGACTTTTCAGCTTTTTT
GATGTTTCAAAAGATTGACATTTCACCATCTTTTTGTAAAATCAGGTTCAGCTCTCCTTT
ATGAAGTAAACATTAAAGAGTAACCAAGTTTGAAAAATAATTTACTTGGGGTTATTCCTT
TTAAAAAATACATGCCAATGTCATTCATATTATGAAATTACAGGCAGAATAACTTAGATT
TCTGGGCATTTCAAAGAAAAGCATCCTGAGTAATATAATTTAATTAATAAAATTAGTTTC
TCAGGAACTTCTTTCTGATCTTACAGACTCTGCAGTGATGCAAATCATTATAACCTTGTG
CCAAACAAGGTATCTGTTAAATGCCACAAATGATAGAAGTAAAATACTATTGTCAGTAGC
AAGTTTACTCTAGTAACTGGATGTTTTATCGTAATCTCATGAAGGTTAGAGCAGAATTGA
ATTGCAGTGCCATCATTTTAATTGAAATTAAAGCAAAAGTCTTAACTCTTTTCCACAGCA
ATTAGAATAAGTACCGTAGTGTAACTTCTCACATTCAGTCATCATTGCAGCCAGCATTTT
TACTTTATCTTCATGTTTTCACAAATGATATCACCTCCTTGGGAAACTGTTAGTTAATAC
CTTACCTTTAGAAAAGGCATAGTAATCATAGCCGTCAGGTTTTCTGATGTTGGGCAGTGA
TATAGCTGAGGTAACCACATTTGGAAGTCCTCTCCACAGTATACTCACTTTAACTTCATT
ATGAAGGACACCTGTAAGTGGCATGTTTAATAAAAGATACCAGATTAAAAGGCAATGTAC
TATCTTGGAAAGAGCCAGACATCTGAGTTTTAATCTCAGTTTTAGCCCTCTGATGTAGAA
CTATTGAGGGTTATAGACTGGTATATAATGTTCTTGGTAAGAAGTACTTGATAAATAGTA
TTGGTTATAACTAACAAACCTGAACAAACTGCTTTACTTACCCACAAGGAAAAAGAAAGT
ATTGGTCTTTGGTTATTCACTAAGGCAAGTGGATGAGTTTTTCATCAGTAAGCTTAAATT
ATTAGGGCTGTTTGATCAGTATCCATATTTCATAAGCCTTACTGTATAAGAAACTGTATT
ACATCTACTTATGTTTAAGGATTTTTTTAACACAATAAAAATGTTACCTTTGTCTTGATA
AGCCAGTCTGGCAGGTGAATATTGAATTCTGATGGTGTGTGTTTGAGAAGGTCCTATAGC
ACGTTCAAAGCGACGTCTCCTAACCTGTGTCGTTTCTCCATACACTGGATAATTTAGAGC
AGGCCTTCTTCCAGGGCACTTCTGTACAGGTTCCTGTTTATAAATATACTGCTGAATGCT
GCCACCTGTTATGTATTAGAATATCACATGGAAAATGAAAATTAATTTTAATACCCTCAG
AAAAGGTGGAAAACAACTTTTACAATGTATAGGAAACAGTTTTGTTCTCATTTTTCATAT
AATATATTGATATTAATAATGGCTATTAGTCAAGGGTATTATAAAAATAATTATTAAACT
GAAATACTTGTTGAATGAATAGATGCAGCAAATTACATAGTTATATATTTAATTTCAATT
GAAAGTGACAAGTGCTCAGTTTGGCAGCACATATACTAAAACTGGAATGATACAGAGATT
AGCATGGCCCTTGTGCAAGGATGACATGCACATTTGTGAAGCGAAAGTAAATGACATTCT
ATCAGTGACCTGAAAACTCAAATGAATTGTGACTTGCCTGTGAAGAAATGAAAATAAAAA
TTGAGGGCAATAAGAATACTACCCTCAATATTGATTTTTTTCACTGAAAATATTTGATTT
CAGCCATTAAAGATATCTTTTGACAGTAAAGTCAATAATAAATGAAAAAAAAAAAAAAAA
AAAAAAA

Protein Sequence

>7175 : length: 2368
MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKR
LSHSQERLVNETRECQSLRLELEKLNNQLKALTEKNKELEIAQDRNIAIQSQFTRTKEEL
EAEKRDLIRTNERLSQELEYLTEDVKRLNEKLKESNTTKGELQLKLDELQASDVSVKYRE
KRLEQEKELLHSQNTWLNTELKTKTDELLALGREKGNEILELKCNLENKKEEVSRLEEQM
NGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAKS
NELTRAVEELHKLLKEAGEANKAIQDHLLEVEQSKDQMEKEMLEKIGRLEKELENANDLL
SATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKLENKRIN
KYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKEIQRLQEDTDKANKQSS
VLERDNRRMEIQVKDLSQQIRVLLMELEEARGNHVIRDEEVSSADISSSSEVISQHLVSY
RNIEELQQQNQRLLVALRELGETREREEQETTSSKITELQLKLESALTELEQLRKSRQHQ
MQLVDSIVRQRDMYRILLSQTTGVAIPLHASSLDDVSLASTPKRPSTSQTVSTPAPVPVI
ESTEAIEAKAALKQLQEIFENYKKEKAENEKIQNEQLEKLQEQVTDLRSQNTKISTQLDF
ASKRYEMLQDNVEGYRREITSLHERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEVR
AENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTNLQTIQGILERSETETKQRLSSQ
IEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTETNLHLNTKELLKNAQKE
IATLKQHLSNMEVQVASQSSQRTGKGQPSNKEDVDDLVSQLRQTEEQVNDLKERLKTSTS
NVEQYQAMVTSLEESLNKEKQVTEEVRKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQD
DKRRAIESMEQQLSELKKTLSSVQNEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQN
KYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQKAESQLLECKASWEERERMLKD
EVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVSLSEEGKSQEQILEIL
RFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAEREKVQVTAKTMAQHE
ELMKKTETMNVVMETNKMLREEKERLEQDLQQMQAKVRKLELDILPLQEANAELSEKSGM
LQAEKKLLEEDVKRWKARNQHLVSQQKDPDTEEYRKLLSEKEVHTKRIQQLTEEIGRLKA
EIARSNASLTNNQNLIQSLKEDLNKVRTEKETIQKDLDAKIIDIQEKVKTITQVKKIGRR
YKTQYEELKAQQDKVMETSAQSSGDHQEQHVSVQEMQELKETLNQAETKSKSLESQVENL
QKTLSEKETEARNLQEQTVQLQSELSRLRQDLQDRTTQEEQLRQQITEKEEKTRKAIVAA
KSKIAHLAGVKDQLTKENEELKQRNGALDQQKDELDVRITALKSQYEGRISRLERELREH
QERHLEQRDEPQEPSNKVPEQQRQITLKTTPASGERGIASTSDPPTANIKPTPVVSTPSK
VTAAAMAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQVESQEAMQSEGPVEHVPV
FGSTSGSVRSTSPNVQPSISQPILTVQQQTQATAFVQPTQQSHPQIEPANQELSSNIVEV
VQSSPVERPSTSTAVFGTVSATPSSSLPKRTREEEEDSTIEASDQVSDDTVEMPLPKKLK
SVTPVGTEEEVMAEESTDGEVETQVYNQDSQDSIGEGVTQGDYTPMEDSEETSQSLQIDL
GPLQSDQQTTTSSQDGQGKGDDVIVIDSDDEEEDDDENDGEHEDYEEDEEDDDDDEDDTG
MGDEGEDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESMGGGEGNHRAADSQNSGEG
NTGAAESSFSQEVSREQQPSSASERQAPRAPQSPRRPPHPLPPRLTIHAPPQELGPPVQR
IQMTRRQSVGRGLQLTPGIGGMQQHFFDDEDRTVPSTPTLVVPHRTDGFAEAIHFCPFSS
PQVAGVPRFRFGPPEDMPQTSSSHSDLGQLASQGGLGMYETPLFLAHEEESGGRSVPTTP
LQVAAPVTVFTESTTSDASEHASQSVPMVTTSTGTLSTTNETATGDDGDEVFVEAESEGI
SSEAGLEIDSQQEEEPVQASDESDLPSTSQDPPSSSSVDTSSSQPKPFRRVRLQTTLRQG
VRGRQFNRQRGVSHAMGGRGGINRGNIN