ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7163

Name

TPD52

Synonym

D52|N8L|PC-1|PrLZ|hD52;tumor protein D52;TPD52;tumor protein D52

Definition

prostate and colon associated protein|prostate leucine zipper|protein N8

Position

8q21.13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Membrane Trafficking;Reactome;REACT:11123

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

7163

Links to epithelial mesenchymal transition gene database

7163

Links to ovarian cancer gene database

7163

Links to endometrial cancer gene database

7163

Links to iHOP

7163

Sequence Information

Nucleotide Sequence

>7163 : length: 4452
CAGTGTCTGATGTTTGCCTGAACTGTTTGTACCTCTGGGCCATATTGCAGAACCCTGCCC
TTCTTTGTTGACTGAGGAAAGCTCGCTCCCTGCCCAGGTTTTTCATTGTTGATCGAAATT
AACACCAGGTGGTGAATAGAGCCCCTCCTAAGGTTGCTCAGGATAAATCATTTATTAAAT
AGGTCTGCTTATCAGGAGGGGCGTGAAGGCTCCCAAAAGGAAATGCTGGCACCTGGGCCC
AGAAGCCAGGGCCTCTAACTCCTGGGGTTGATTTCTTCAGTGAAGTTGCACCCTACAAAG
GGAATATGGCCAAAGCGGCACTCAACTGAAGGCTGATATCAGGCGATTAGACAGCCATGC
ATTCTGCGTTTGTCTGGAATGGATTGTAGAGAGATGGACTTATATGAGGACTACCAGTCC
CCGTTTGATTTTGATGCAGGAGTGAACAAAAGCTATCTCTACTTGTCTCCTAGTGGAAAT
TCATCTCCACCCGGATCACCTACTCTTCAGAAATTTGGTCTGCTGAGAACAGACCCAGTC
CCTGAGGAAGGAGAAGATGTTGCTGCCACGATCAGTGCCACAGAGACCCTCTCGGAAGAG
GAGCAGGAAGAGCTAAGAAGAGAACTTGCAAAGGTAGAAGAAGAAATCCAGACTCTGTCT
CAAGTGTTAGCAGCAAAAGAGAAGCATCTAGCAGAGATCAAGCGGAAACTTGGAATCAAT
TCTCTACAGGAACTAAAACAGAACATTGCCAAAGGGTGGCAAGACGTGACAGCAACATCT
GCGAGGAGCAAGCTTCTAGCAGCAGAAACCGAACTGCTCTGTCTTCTGTATTGAGAGCCA
TCTGCAGAGCTGTTACAAGAAGACATCTGAAACCTTATCCCAGGCTGGACAGAAGGCCTC
AGCTGCTTTTTCGTCTGTTGGCTCAGTCATCACCAAAAAGCTGGAAGATGTAAAATTGCA
AGCCTTTTCACATTCCTTTAGTATACGTTCCATTCAGCATTCAATTAGCATGCCTGCTAT
GAGAAACTCCCCAACTTTTAAATCATTTGAAGAAAAGGTCGAAAACTTAAAGTCTAAAGT
AGGGGGAACCAAGCCTGCTGGTGGTGATTTTGGAGAAGTCTTGAATTCGGCTGCAAATGC
TAGTGCCACCACCACGGAGCCTCTTCCAGAAAAGACACAGGAGAGCCTGTGAGATTCCTA
CCTTTGTTCTGCTACCCACTGCCAGATGCTGCAAGCGAGGTCCAAGCACATCTTGTCAAC
ATGCATTGCCATGAATTTCTACCAGATGTGCTTTTATTTAGCTTTACATATTCCTTTGAC
CAAATAGTTTGTGGGTTAAACAAAATGAAAATATCTTCACCTCTATTCTTGGGAAACACC
CTTTAGTGTACATTTATGTTCCTTTATTTAGGAAACACCATTATAAAAACACTTATAGTA
AATGGGGACATTCACTATAATGATCTAAGAAGCTACAGATTGTCATAGTTGTTTTCCTGC
TTTACAAAATTGCTCCAGATCTGGAATGCCAGTTTGACCTTTGTCTTCTATAATATTTCC
TTTTTTTCCCCTCTTTGAATCTCTGTATATTTGATTCTTAACTAAAATTGTTCTCTTAAA
TATTCTGAATCCTGGTAATTAAAAGTTTGGGTGTATTTTCTTTACCTCCAAGGAAAGAAC
TACTAGCTACAAAAAATATTTTGGAATAAGCATTGTTTTGGTATAAGGTACATATTTTGG
TTGAAGACACCAGACTGAAGTAAACAGCTGTGCATCCAATTTATTATAGTTTTGTAAGTA
ACAATATGTAATCAAACTTCTAGGTGACTTGAGAGTGGAACCTCCTATATCATTATTTAG
CACCGTTTGTGACAGTAACCATTTCAGTGTATTGTTTATTATACCACTTATATCAACTTA
TTTTTCACCAGGTTAAAATTTTAATTTCTACAAAATAACATTCTGAATCAAGCACACTGT
ATGTTCAGTAGGTTGAACTATGAACACTGTCATCAATGTTCAGTTCAAAAGCCTGAAAGT
TTAGATCTAGAAGCTGGTAAAAATGACAATATCAATCACATTAGGGGAACCATTGTTGTC
TTCACTTAATCCATTTAGCACTATTTAAAATAAGCACACCAAGTTATATGACTAATATAA
CTTGAAAATTTTTTATACTGAGGGGTTGGTGATAACTCTTGAGGATGTAATGCATTAATA
AAAATCAACTCATCATTTTCTACTTGTTTTCAATGTGTTGGAAACTGTAAAATGATACTG
TAGAACCTGTCTCCTACTTTGAAAACTGAATGTCAGGGCTGAGTGAATCAAAGTGTCTAG
ACATATTTGCATAGAGGCCAAGGTATTCTATTCTAATAACTGCTTACTCAACACTACCAC
CTTTTCCTTATACTGTATATGATTATGGCCTACAATGTTGTATTTGTTATTTATTAAATT
GTGATTGTTTTATTATTGTTTATGCCAAATGTTAACTGCCAAGCTTGGAGTGACCTAAAG
CATTTTTTAAAAGCATGGCTAGATTTACTTCAGTATAAATTATCTTATGAAAACCAAATT
TTAAAAGCCACAGGTGTTGATTGTTATAAAATAACATGCTGCCATTCTTGATTGCTAGAG
TTTTTGTTAGTACTTTGGATGCAATTAAAACTATGTGCTATCACATGTGAAAAGCTTAAT
AAATTCCATCTATCAGTAGTATAGGTCTCAATATTTATTATGAGACCAGTGGTCTGGAAA
CAGCTTGTTGTACCGAATCAACTGGAGTCTATGCTTAAAAAAAAAAAATTTTTTTTTAAC
CATCCTTAAATTATTGCTTAATGGTATCATATTAACATATTCTAAATAAGGGCTTTAAGG
CACAGGCTGTTGAAGCATTTTCTCAGAGGAGTGGATCTGTAGAAGTCTGTCTTTCTATAG
AAATATTGTGCTTACTCAAGTGTTAAATTATTTTTTCTATGAACTAGTCTACTTCTTAAA
ATTCAAACATATTCTTTTGATCACATTGTTTCTTGAGCATCCTGCCCTGCTACTAACTTT
TCAACAAGGCAAAATGGAGTAAAGTGGCAATTTCTTTAGATGAGTGAAATACCCTCAAGT
CTCTTTTCTGCCCAAAAAGGGAAAAGTGATAGAAATGGGGGTGGCAAGTGGGGTGAGTGG
ATGAAGGTGGGTATTGGGGGTGGCTGTGAAAGAAAATAATGGAGAATCACTTTTCTAGAC
ATCTACCTATACTTAATCTAAGAAACAAAGTAATCTACTGTAAAGTACTCTGCCCCTTGA
AAGAAGTATTAAAAAGAGTGAGGATGGATTTAGAAAAAAACATGAATTTAGAAATATTCA
AAATGGTTTTTGTGGCAGATTCAATATTATGAATTCACAGATATTTAAAGAATGAGAAAC
ATAGTAATTAGTAGAAATGCCAGAAACAGTTCCTGGTTCCTCTTGTGTTTGACACTAAGA
AAATAGCAAGAGTGTGAAATCTCAGATACTTATGAAATCTCACAGATGTAAGGACTCAAG
TGTAGAAGAAAATATCCCCTTCTTACAAAAAGAAATGTCAATTTATGGAGTTTGTGGGAA
ATAGGGCAAGAATTCTTATGCTTATGAGAGCCAAGTAGTCAGTGGAAGAGAGTAGAGCTC
AAAACTGGATTATCACCTTAGCAACTTAGAATAGTTTGAAATAGAAAAAAAGTATTTAAT
TTGGATCTGGATCTGTTAAGATATGCACAGTCTATTTTTTGTATAGTATTGGAAAATAAA
AATGCTATAATTTGGGTATGGGTTCTTTTGTATACATTACCTGCCCATTGAGGAAAGGGG
CAAGTCCATTATGCAACTTCTCTCCAAACCCTTCATATTCTGGATATGATACTTAAAGAG
CCATGAGCAGCTACATTCTGCCTATCAGAAGGCATTTATTAAATGACTGCTTGCTGAAGA
TGTGTCCAAAGAGATCCTACATTAAGGTCATTTGTCAGAATGATGTTTGTGTTTGTTTAG
AGTTGGCTGACCTCCAACTCCTGGGGTCAAGGAATCCTACTGCCTTAGCTTCCCAAATAG
CTAGGACTATAGGCATGCACCCGGCCATGTGTTTTATTTATAGCTCTTAAAGCCCAGATG
AAGAAATCACATTTTTGCCCATAGTGAAGAAACATTTGGCCATTGATTAGTCCTTATTTT
CAGTGACTGTCCTGTTTTCATTAGATTAGAGAGACCCTGTGTGGGCCACAGTTAATATAA
ACCATTATCACTTTTAAGTAAACCTGCACATCTTAGATTTCATAATTTCCTTATTGTTCT
GACTCAAAATGAACTAAGAGCTTTTCACTTTTTGTTTGTAAGTTCTCAGAGAGTCGGGTC
TGCAAGTGCTTTTGCCTGCCAGGATTTTGTACTCAAATAAATGCTATTTGGCAACTAAAA
AAAAAAAAAAAA

Protein Sequence

>7163 : length: 247
MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKFGLLRTDPVPEEGED
VAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELK
QNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKLQAFSHSFSIR
SIQHSISMPAMRNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLP
EKTQESL