ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7161

Name

TP73

Synonym

P73;tumor protein p73;TP73;tumor protein p73

Definition

p53-like transcription factor|p53-related protein

Position

1p36.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

atm signaling pathway;PID BioCarta;100235

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

p53 pathway;PANTHER;P00059

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

p53 pathway by glucose deprivation;PANTHER;P04397

Pathway

P53 pathway feedback loops 1;PANTHER;P04392

Pathway

p53 pathway feedback loops 2;PANTHER;P04398

Pathway

p53 signaling pathway;KEGG PATHWAY;hsa04115

Pathway

Huntington disease;PANTHER;P00029

Disease

Drug abuse;FunDO

Disease

Cancers;KEGG DISEASE

Disease

esophageal cancer;GAD

Disease

Fanconi's anemia;FunDO

Disease

lung cancer;GAD

Disease

PHARMACOGENOMIC;GAD

Disease

breast cancer;GAD

Disease

Hepatocellular carcinoma;KEGG DISEASE;H00048

Disease

head and neck cancer;GAD

Disease

endometrial cancer;GAD

Disease

CANCER;GAD

Disease

Cancer;FunDO

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

esophageal cancer gastric cardiac cancer;GAD

Disease

Neuroblastoma;OMIM

Disease

Leukoencephalopathy;FunDO

External Links

Links to cell senescence gene database

7161

Links to epithelial mesenchymal transition gene database

7161

Links to ovarian cancer gene database

7161

Links to endometrial cancer gene database

7161

Links to iHOP

7161

Sequence Information

Nucleotide Sequence

>7161 : length: 5154
AGGGGACGCAGCGAAACCGGGGCCCGCGCCAGGCCAGCCGGGACGGACGCCGATGCCCGG
GGCTGCGACGGCTGCAGAGCGAGCTGCCCTCGGAGGCCGGCGTGGGGAAGATGGCCCAGT
CCACCGCCACCTCCCCTGATGGGGGCACCACGTTTGAGCACCTCTGGAGCTCTCTGGAAC
CAGACAGCACCTACTTCGACCTTCCCCAGTCAAGCCGGGGGAATAATGAGGTGGTGGGCG
GAACGGATTCCAGCATGGACGTCTTCCACCTGGAGGGCATGACTACATCTGTCATGGCCC
AGTTCAATCTGCTGAGCAGCACCATGGACCAGATGAGCAGCCGCGCGGCCTCGGCCAGCC
CCTACACCCCAGAGCACGCCGCCAGCGTGCCCACCCACTCGCCCTACGCACAACCCAGCT
CCACCTTCGACACCATGTCGCCGGCGCCTGTCATCCCCTCCAACACCGACTACCCCGGAC
CCCACCACTTTGAGGTCACTTTCCAGCAGTCCAGCACGGCCAAGTCAGCCACCTGGACGT
ACTCCCCGCTCTTGAAGAAACTCTACTGCCAGATCGCCAAGACATGCCCCATCCAGATCA
AGGTGTCCACCCCGCCACCCCCAGGCACCGCCATCCGGGCCATGCCTGTTTACAAGAAAG
CGGAGCACGTGACCGACGTCGTGAAACGCTGCCCCAACCACGAGCTCGGGAGGGACTTCA
ACGAAGGACAGTCTGCTCCAGCCAGCCACCTCATCCGCGTGGAAGGCAATAATCTCTCGC
AGTATGTGGATGACCCTGTCACCGGCAGGCAGAGCGTCGTGGTGCCCTATGAGCCACCAC
AGGTGGGGACGGAATTCACCACCATCCTGTACAACTTCATGTGTAACAGCAGCTGTGTAG
GGGGCATGAACCGGCGGCCCATCCTCATCATCATCACCCTGGAGATGCGGGATGGGCAGG
TGCTGGGCCGCCGGTCCTTTGAGGGCCGCATCTGCGCCTGTCCTGGCCGCGACCGAAAAG
CTGATGAGGACCACTACCGGGAGCAGCAGGCCCTGAACGAGAGCTCCGCCAAGAACGGGG
CCGCCAGCAAGCGTGCCTTCAAGCAGAGCCCCCCTGCCGTCCCCGCCCTTGGTGCCGGTG
TGAAGAAGCGGCGGCATGGAGACGAGGACACGTACTACCTTCAGGTGCGAGGCCGGGAGA
ACTTTGAGATCCTGATGAAGCTGAAAGAGAGCCTGGAGCTGATGGAGTTGGTGCCGCAGC
CACTGGTGGACTCCTATCGGCAGCAGCAGCAGCTCCTACAGAGGCCGAGTCACCTACAGC
CCCCGTCCTACGGGCCGGTCCTCTCGCCCATGAACAAGGTGCACGGGGGCATGAACAAGC
TGCCCTCCGTCAACCAGCTGGTGGGCCAGCCTCCCCCGCACAGTTCGGCAGCTACACCCA
ACCTGGGGCCCGTGGGCCCCGGGATGCTCAACAACCATGGCCACGCAGTGCCAGCCAACG
GCGAGATGAGCAGCAGCCACAGCGCCCAGTCCATGGTCTCGGGGTCCCACTGCACTCCGC
CACCCCCCTACCACGCCGACCCCAGCCTCGTCAGTTTTTTAACAGGATTGGGGTGTCCAA
ACTGCATCGAGTATTTCACCTCCCAAGGGTTACAGAGCATTTACCACCTGCAGAACCTGA
CCATTGAGGACCTGGGGGCCCTGAAGATCCCCGAGCAGTACCGCATGACCATCTGGCGGG
GCCTGCAGGACCTGAAGCAGGGCCACGACTACAGCACCGCGCAGCAGCTGCTCCGCTCTA
GCAACGCGGCCACCATCTCCATCGGCGGCTCAGGGGAACTGCAGCGCCAGCGGGTCATGG
AGGCCGTGCACTTCCGCGTGCGCCACACCATCACCATCCCCAACCGCGGCGGCCCAGGCG
GCGGCCCTGACGAGTGGGCGGACTTCGGCTTCGACCTGCCCGACTGCAAGGCCCGCAAGC
AGCCCATCAAGGAGGAGTTCACGGAGGCCGAGATCCACTGAGGGCCTCGCCTGGCTGCAG
CCTGCGCCACCGCCCAGAGACCCAAGCTGCCTCCCCTCTCCTTCCTGTGTGTCCAAAACT
GCCTCAGGAGGCAGGACCTTCGGGCTGTGCCCGGGGAAAGGCAAGGTCCGGCCCATCCCC
AGGCACCTCACAGGCCCCAGGAAAGGCCCAGCCACCGAAGCCGCCTGTGGACAGCCTGAG
TCACCTGCAGAACCTTCTGGAGCTGCCCTAGTGCTGGGCTTGTGGGGCGGGGGCTGGCCC
ACTCTCAGCCCTGCCACTGCCCCGGCGTGCTCCATGGCAGGCGTGGGTGGGGACCGCAGC
GTCGGCTCCGACTTCCAGGCTTCATCCTAGAGACTGTCATCTCCCAACCAGGCGAGGTCC
TTCCAAAGGAAAGGATCCTCTTTGCTGATGGACTGCCAAAAAGTATTTTGCGACATCTTT
TGGTTCTGGATAGTAGTGAGCAGCCAAGTGACTGTGTCTGAAACACCAGTGTATTTTCAG
GGAATGTCCCTAACTGCGTCTTGCCCGCGCCGGGGGCTGGGGACTCTCTCTGCTGGACTT
GGGACTGGCCTCTGCCCCCAGCACGCTGTATTCTGCAGGACCGCCTCCTTCCTGCCCCTA
ACAACAACCACAGTGTTGCTGAAATTGGAGAAAACTGGGGAGGGCGCAACCCCCCCCAGG
CGCGGGGAAGCATGTGGTACCGCCTCAGCCAGTGCCCCTCAGCCTGGCCACAGTCGCCTC
TCCTCGGGGACCCCTCAGCAGAAAGGGACAGCCTGTCCTTAGAGGACTGGAAATTGTCAA
TATTTGATAAAATGATACCCTTTTCTACATGGTGGGTCAGCTTTTTTTTTTTTTTTTTTA
ACTTTCTTTCTCAGCATTCTCTTTGGAGTTCAACCTAGCGCCCATGAGCCAGGCTGAGGA
AGCTGAGTGAGAAGCCAGGTGGGCGGGACTTGTTCCCAGGAAGGCCGGGTGGGGAGGAAG
CCTAGAGGGAACCCCAGGAAGGGCAAATCCAGGCAAATCTGCAGGAATGCTCTGCCATGG
GAGCAGCTCCTCCCTTGCCACGGCCACCTTCTCTAGCACTGCAAGGTCCACAGGGCATTG
CTTTCCTTTCTAGGCGGTGGCAGTCAGGGAACAGACTGAGGTAGGTGTAGGGGGGTCTAG
GCCTTCGTGGAGCACCCCAGGGAGTTAGTAGGCCCCGGGGAGACAGAGTCTGCACAGGCC
CTTTCTGGGGCCACCTCCATCCACGAGGAGCAGCCTGAGCCTTGGTGGCCGAACCTTGAC
CGTCCCGGAGCACAGCTTCAGGGCAGGGAACCGGAGCCCCTGGGGGGCCTCACGGGTGTG
ACGAGGCCCTTCATTGCAGGCAGGTGGGCCAATGGGAGCCCTCACCCACGCAAGCCGAGA
CACCACCCAGAGTGCAGGCTGCCTGGCCCCTTCTGGCACGGCCAGCTCCACACCCCCTGC
CTAGGGTATGTGTGGTCCTAAGGGCTAGGAGCTTCCCCTACTAACATCTCCCAGAAAAAG
CAGTTAAGCCCCTCAGGGCACAGCAAGGTTAGACACAGCCCCCATCCCCAGATCAGGACT
CCATCTTGCTAAGTGGCATCACCGTCACCAGCCTCCCCTTATTTAAAAGCAGCGACTGGT
GTTGCCGCAGGTACCTGGTCTACGAAGACGCAGGCATCCCTCTCCCACCGTCCACCTCCC
CGGGGGCCGCTGACAGCACAGTCGCCTGGGTGCACGCTTGTGGGGGCAGCAGGAACGGGG
CTGTCGGCTCTCAGGGGATCTGGCTGCAGCCAGGGCGAGGGCCTGGCCCTTCCTTCCAGC
TCCTTCCGGCTCCTTCCAGCTGAAGGGCAGGAAGCTCTGGCCGCTTAGCTTCTAGGGTTC
CATCTCCCTAGAAAGGTGCCCACGCCCAGGGCATCAGTCAGTAGCGGCAGCAGCAGCAGA
CTCGGGGCTTTCCCAGGGTGGCGCAGCCACCCCAGCTGCATGTCACCTCAGCTCTCCATC
TTATTGCCATTTTGTAGATGAGGAAGCTGAGACCAGAAAGGCTAAGACCCATGCCCCAGG
CACCACACCCATCTCTTGGGGGCTGGGCACCTGCTACCCGAGGCCACCTCCTGAAGCCCC
CACTCTTCCCCCATGTTCCACTTCAGGAGCCGCGGGGGCCCATCCTGACACCCGGGGTTC
CTCAGCCCAGCGCAGATGTGCTTCAGTTCCAGAGGGCTTGTTGATTTGTTTCTTAGGTAC
GTTACCTGTCCACCCTGAGTCCAGTGAGGCTGTCCCAAGAGCCCCTGTAGTGTGCTCCTG
GGAAGGGCTGGGGGGGCTGGGGGGGCTGGGAGAGGCCCAGGGGCAGCTGTCACTGGAACC
CCAGCCAGATGTCCAAGGAAGCCGGCCAGAACACGGAGCAGCCAGATGGCCCCAGCTGCA
CCTGTCTAGGGAGCCCATGCAGCCTCCTTGCACTGGAGAAGCAGCTGTGAAAGTAGACAG
AGTTGAGACTTCGCCGTGGTCAGGAGAAAATGCAAATTCCCAGGAACAAGAATCCTTTAA
GTGATATGTTTTTATAAAACTAAACAAATCAACAAATAAATCTTGAAGGCGGATGGTTTT
CCCAGCAGTGCAGGGGTTGGAGGGAGGCTGCTGGCACTCCTGGGGCCAAGGGGGACAGGC
AGTGGTCCTGAGTCTGCTCAGAGAGGCAAGGCAGAAGGAGCTCGCCAGGCAGGTCAGCTC
ACATCTGTCCAAGTCGCTCTGGTCAGAAACAGCGACTCTCCCCCATTCCCCCAGCGTTCC
CACCAGGCCTGGGCTGCTGGGAAGCCCTTGCTGTACCCAGGAGCCCGACCCGCAGTATCC
TGGCACAGAGCCACTTGTCACTCAGAACAGTCAGTGTCTCCAACGCACAAACATCCACTC
CTCTGTTACCAGTTAAAGCACTTTAATGCTTTAAGGTGAAAACGAAATCCCATCCGTGTT
TTTCGTGTAAGATCGTGCTTCTCCGAGCAGTATTAATGGACGCCCTCCAATGACATAACA
ACTGTTTTTGGTAATGTAATCTTGGGAAAATGTGTTATTTTTTTAGCTGTGTTTCAGTGG
GGATTTTTGTTTTTGTAACATAATAAAGTGTATGTTCCAATGAAAAAAAAAAAA

Protein Sequence

>7161 : length: 636
MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTS
VMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTD
YPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPV
YKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPY
EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGR
DRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRHGDEDTYYLQVR
GRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGPVLSPMNKVHGG
MNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSSHSAQSMVSGSH
CTPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMT
IWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRG
GPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH