ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7113

Name

TMPRSS2

Synonym

PP9284|PRSS10;transmembrane protease, serine 2;TMPRSS2;transmembrane protease, serine 2

Definition

epitheliasin|serine protease 10|transmembrane protease serine 2

Position

21q22.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Pathway

Regulation of Androgen receptor activity;PID Curated;200102

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

7113

Links to epithelial mesenchymal transition gene database

7113

Links to ovarian cancer gene database

7113

Links to endometrial cancer gene database

7113

Links to iHOP

7113

Sequence Information

Nucleotide Sequence

>7113 : length: 3299
AGCTAAGTCAGTCCTGGCTCCTGAGCTGCTGCTGTGAAGGGAGGACCTGGTGGGCTAGGT
AACCGGGAGCTCCCCCAGAAAGTCACTGGAGGTTGCTCAGGACTTCCCCACCTTTACTGA
GTGCTTTTGAAGAAGTAGGACCTGCCCTGCTCCGCTACAGAACTACTGGACAGGTCATAT
TGAACATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTTGAA
CTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAA
CCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTA
CTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCCCGT
CGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAAGC
ACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCT
ACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGG
TACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGA
CGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCA
GAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGC
CTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAG
CGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAA
ACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTG
CGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCC
GGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTC
CATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAA
TCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGC
CGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAA
TGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGT
GTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTG
GGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCT
CATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACACCAGCCAT
GATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCC
TCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGG
CTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACGGACTGGAT
TTATCGACAAATGAGGGCAGACGGCTAATCCACATGGTCTTCGTCCTTGACGTCGTTTTA
CAAGAAAACAATGGGGCTGGTTTTGCTTCCCCGTGCATGATTTACTCTTAGAGATGATTC
AGAGGTCACTTCATTTTTATTAAACAGTGAACTTGTCTGGCTTTGGCACTCTCTGCCATT
CTGTGCAGGCTGCAGTGGCTCCCCTGCCCAGCCTGCTCTCCCTAACCCCTTGTCCGCAAG
GGGTGATGGCCGGCTGGTTGTGGGCACTGGCGGTCAAGTGTGGAGGAGAGGGGTGGAGGC
TGCCCCATTGAGATCTTCCTGCTGAGTCCTTTCCAGGGGCCAATTTTGGATGAGCATGGA
GCTGTCACCTCTCAGCTGCTGGATGACTTGAGATGAAAAAGGAGAGACATGGAAAGGGAG
ACAGCCAGGTGGCACCTGCAGCGGCTGCCCTCTGGGGCCACTTGGTAGTGTCCCCAGCCT
ACCTCTCCACAAGGGGATTTTGCTGATGGGTTCTTAGAGCCTTAGCAGCCCTGGATGGTG
GCCAGAAATAAAGGGACCAGCCCTTCATGGGTGGTGACGTGGTAGTCACTTGTAAGGGGA
ACAGAAACATTTTTGTTCTTATGGGGTGAGAATATAGACAGTGCCCTTGGTGCGAGGGAA
GCAATTGAAAAGGAACTTGCCCTGAGCACTCCTGGTGCAGGTCTCCACCTGCACATTGGG
TGGGGCTCCTGGGAGGGAGACTCAGCCTTCCTCCTCATCCTCCCTGACCCTGCTCCTAGC
ACCCTGGAGAGTGCACATGCCCCTTGGTCCTGGCAGGGCGCCAAGTCTGGCACCATGTTG
GCCTCTTCAGGCCTGCTAGTCACTGGAAATTGAGGTCCATGGGGGAAATCAAGGATGCTC
AGTTTAAGGTACACTGTTTCCATGTTATGTTTCTACACATTGCTACCTCAGTGCTCCTGG
AAACTTAGCTTTTGATGTCTCCAAGTAGTCCACCTTCATTTAACTCTTTGAAACTGTATC
ATCTTTGCCAAGTAAGAGTGGTGGCCTATTTCAGCTGCTTTGACAAAATGACTGGCTCCT
GACTTAACGTTCTATAAATGAATGTGCTGAAGCAAAGTGCCCATGGTGGCGGCGAAGAAG
AGAAAGATGTGTTTTGTTTTGGACTCTCTGTGGTCCCTTCCAATGCTGTGGGTTTCCAAC
CAGGGGAAGGGTCCCTTTTGCATTGCCAAGTGCCATAACCATGAGCACTACTCTACCATG
GTTCTGCCTCCTGGCCAAGCAGGCTGGTTTGCAAGAATGAAATGAATGATTCTACAGCTA
GGACTTAACCTTGAAATGGAAAGTCATGCAATCCCATTTGCAGGATCTGTCTGTGCACAT
GCCTCTGTAGAGAGCAGCATTCCCAGGGACCTTGGAAACAGTTGGCACTGTAAGGTGCTT
GCTCCCCAAGACACATCCTAAAAGGTGTTGTAATGGTGAAAACGTCTTCCTTCTTTATTG
CCCCTTCTTATTTATGTGAACAACTGTTTGTCTTTTTTTGTATCTTTTTTAAACTGTAAA
GTTCAATTGTGAAAATGAATATCATGCAAATAAATTATGCAATTTTTTTTTCAAAGTAA

Protein Sequence

>7113 : length: 529
MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSGSPPAIGPYYENHGYQPE
NPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKK
ALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGE
DENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDD
SGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESAL
PGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYG
AGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISG
WGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGG
PLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG