ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7088

Name

TLE1

Synonym

ESG|ESG1|GRG1;transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila);TLE1;transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila)

Definition

enhancer of split groucho-like protein 1|transducin-like enhancer protein 1

Position

9q21.32

Gene Type

protein-coding

Pathways and Diseases

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

wnt signaling pathway;PID BioCarta;100002

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Notch-mediated HES/HEY network;PID Curated;200196

Disease

Leukemia;FunDO

Disease

Synovial sarcoma;FunDO

External Links

Links to cell senescence gene database

7088

Links to epithelial mesenchymal transition gene database

7088

Links to ovarian cancer gene database

7088

Links to endometrial cancer gene database

7088

Links to iHOP

7088

Sequence Information

Nucleotide Sequence

>7088 : length: 4167
GCGAGAGGCGCGGGCGGCGGCGGCGGTGGGAGCGGCGGCTGCAGAAGCAGCAGCAGCAGA
AACAGCGGCGGGTACTCTGTGCCCCGCGTCCCGGAGGCAGCCGACTGCGCCACCCCACCC
TCGCACGGCCGGGCGGGACCCGCGCCACCAGCCCGGACCTCCGTCGTCCCGCGGCGACCA
AAACCCCCGCTGGCCCCACCGCTGTGACTACTCTGGACTCGCCCGCAGAGTTTGCCCGCC
GGGGAGGGTGGCCGATTGGCGGAGCGCACTCCTGCTGTTTTCCCCACCATCTCGTGGATG
TCGTCCCTCGGGTGGTGAGAGAACTTTGCAGTGGGCTGGAGCGCCCTTTGCGGAGAAGCA
CACGAAGGTGAAGGAAGGAAAGAAAGAAGACCGAGGAAGAAGGAGCTCGGAAGAAGGGTC
CGGAGCGGCCGGTCCGGCCGTGCAGGGCGAGTGCGCCCGAGGCGCGGCGCCCTGATGCTC
CCCGGGCTCGAGGAGCATTGGGCACTTGCGGGACTGCTCTCGGTGGAGTAGCCCCGTCGG
GCCCGGAGGGTTTGTGCAACCGCGGAGAACACCGAGTGCTGGTCGCACGGGGCGTGCCGA
GCCGCCTCCCGGCGCGCCCTCCGCACTTTCCCCGCCTCGTCATCCGTCGCTCCCCGGCCA
GGAGCCTCCGCTGCGTCTTCAACCTCGCTCCCCTTTGCGTCCCGGGAGCCTGCGAGCACC
CGGCCGAAGGCGCAGCCGAATCTTGCGGGAGTCGCCCCGAAAGCGTCGGGTTTGTGTGGG
GTTAGCGGGGGCCGCCGCGCCACCTGCACCTCGCCCGCCGCCGCCTCGGGGAAAGCCCGA
AGAGGAGGCGGACCAGGAGAAGAGCAAAGAAAAGCAGTCCGTCTGGATTTGTTTGCCCAG
GACTGGCGCCGCGCACGCGGATCGCCGAGGGGAGTGCGGTCGGAGTCACCGCGCCCCCGC
CTCCCCGCCCGGGCAGCTGAGGCCGGGGGTTGGAGCGCTGCCCCCGCGCACAGTCCCCGA
GCGCCCGACGTCTCCGCGCAGGTTCTTGAAGCAGCTGGGCCTGGGGCGCCCACTAATGTG
GCCCTGAGGGCCGGAGCCCGCACCGACGGGAGCGGGAGCCGGAGCAGCTGCGGGCGCCGA
GTGGCCGGTGCGCCCGGCGGAGCGCGCGTGCGTGGCCAGCGCGCTCCCCGCTTCTGCTTG
GCTTTCCGGCTTAATTTTCCTCGGCGGGATTAAAGTTGGAAATTGACCGGAGAATTGAGT
TGCCGGGGAACAGAGCCCCGGCCGCCGCCAGAGCGATGTTCCCGCAGAGCCGGCACCCGA
CGCCGCACCAGGCTGCAGGCCAGCCCTTCAAGTTCACTATCCCGGAGTCCCTGGACCGGA
TTAAAGAGGAATTCCAGTTCCTGCAGGCGCAGTATCACAGCCTTAAATTGGAATGTGAGA
AACTGGCAAGTGAAAAGACAGAAATGCAGAGGCACTATGTGATGTATTATGAAATGTCAT
ATGGATTAAACATTGAAATGCACAAACAGACTGAAATCGCCAAGAGATTGAATACGATTT
GTGCACAAGTCATCCCATTTCTGTCTCAGGAACATCAACAACAGGTGGCCCAGGCTGTTG
AACGTGCCAAACAGGTGACCATGGCAGAATTGAATGCCATCATCGGGGTACGTGGCCTAC
CAGGTCTACCTCCTACACAGCAGCAGTTGCAAGCTCAGCATCTTTCTCATGGCCACGGAC
CCCCAGTTCCCCTTACGCCTCACCCTTCGGGACTTCAGCCTCCTGGAATCCCGCCCCTCG
GGGGCAGTGCCGGCCTTCTTGCGCTGTCTAGTGCTCTGAGTGGGCAGTCTCACTTGGCAA
TAAAAGATGACAAGAAGCACCACGATGCAGAGCACCACAGAGACAGAGAGCCGGGCACAA
GTAATTCCCTCCTGGTCCCAGACAGTCTAAGAGGCACAGATAAACGCAGAAATGGACCTG
AATTTTCCAATGACATCAAGAAAAGGAAGGTGGATGATAAGGACTCCAGCCACTATGACA
GTGATGGTGACAAAAGCGATGACAACTTAGTTGTGGATGTGTCTAATGAGGACCCTTCTT
CTCCGCGAGCAAGCCCTGCCCACTCGCCCCGGGAAAATGGAATCGACAAAAATCGCCTGC
TAAAGAAGGATGCTTCTAGCAGTCCAGCTTCCACGGCCTCCTCGGCAAGTTCCACTTCTT
TGAAATCCAAAGAAATGAGCTTGCATGAAAAAGCCAGCACGCCTGTTCTGAAATCCAGCA
CACCAACGCCTCGGAGCGACATGCCAACGCCGGGCACCAGCGCCACTCCAGGCCTCCGTC
CAGGTCTCGGCAAGCCTCCAGCCATAGACCCCCTCGTTAACCAAGCGGCAGCTGGCTTGA
GGACACCCCTGGCAGTGCCCGGCCCATATCCTGCTCCTTTTGGGATGGTCCCCCACGCTG
GCATGAACGGCGAGCTGACCAGCCCAGGCGCTGCCTACGCCAGTTTACACAACATGTCGC
CCCAGATGAGCGCCGCAGCCGCCGCGGCCGCCGTGGTGGCCTACGGGCGCTCCCCCATGG
TGGGGTTTGATCCTCCCCCTCACATGAGAGTACCTACCATTCCTCCAAACCTGGCAGGAA
TCCCTGGGGGGAAACCTGCATACTCCTTCCACGTTACTGCAGACGGTCAGATGCAGCCTG
TCCCTTTTCCCCCCGACGCCCTCATCGGACCCGGAATCCCCCGGCATGCTCGCCAGATCA
ACACCCTCAACCACGGGGAGGTGGTGTGCGCTGTGACCATCAGCAACCCCACGAGACACG
TGTACACAGGCGGGAAGGGCTGCGTCAAGGTCTGGGACATCAGCCACCCTGGCAATAAGA
GCCCTGTCTCCCAGCTCGACTGTCTGAACAGAGACAATTATATCCGTTCCTGTAAATTGC
TACCCGATGGCTGCACTCTCATAGTGGGAGGGGAAGCCAGTACTTTGTCCATTTGGGACC
TGGCGGCTCCAACCCCGCGCATCAAGGCGGAGCTGACGTCCTCGGCCCCCGCCTGCTACG
CCCTGGCCATCAGCCCCGATTCCAAGGTCTGCTTCTCATGCTGCAGCGACGGCAACATCG
CTGTGTGGGATCTGCACAACCAGACACTAGTGAGGCAATTCCAGGGCCACACAGACGGAG
CCAGCTGTATTGACATTTCTAATGATGGCACCAAGCTCTGGACGGGTGGTTTGGACAACA
CAGTCAGGTCCTGGGACCTGCGCGAGGGGCGGCAGCTGCAGCAGCACGACTTCACCTCCC
AGATCTTCTCCCTGGGGTACTGCCCCACCGGGGAGTGGCTGGCAGTGGGCATGGAGAGCA
GCAATGTGGAGGTGCTGCACGTGAACAAGCCTGACAAGTACCAGCTGCACCTGCATGAGA
GCTGCGTGCTGTCCCTGAAATTTGCTTACTGTGGTAAATGGTTTGTGAGTACTGGAAAAG
ATAACCTCCTCAATGCTTGGCGGACCCCCTATGGAGCCAGCATATTCCAGTCCAAAGAGT
CCTCGTCAGTGCTTAGCTGTGACATCTCTGTGGATGATAAGTACATAGTCACTGGCTCGG
GGGACAAGAAGGCTACAGTCTATGAAGTCATCTACTGAAAACATTATGTGGTTTAACGTT
TATAGTTGAATTGGGCCAAAATGTTTCGAATTTATAGAAATAGAAAAGTTGTAACTTTAA
AAGAGAAAAAAAATTACAAACACCTGTTTCCAAACCTTGACAGAAAACTACTTTGAGTCT
ACAAAGAGGAGGCGACAAGTCCATCAGCAGAAAGTCACCTGTCTACATAGACCAAATGGA
GCACCAAGGCCAAGCGGACAGAGGGGCCATGGGTTGTAGGATTGAGGAACGGAATCTGCC
GACTCACATGACAGCCCATTCTTTCTTTCTGGGTGATCTGGGGATCACGCCTTGCCCAAG
TGTGAGATTACCTTTCTGTTCCTTGCAGTTCACCTCACTTTCCGTCCTTTGTAGAGCAGT
GGTGTCTCCAATGAACTTGTTTCCTGGTTTTGCATCTTGTGAAATGTTTTTTTGTATTTT
TGTTGAAGGTTAAACATTTGTATAAATTGTAAATATATTTGGTTTATTACAGTAAAGGCT
TTAGTACCAATAAAAAAAAAAAAAAAA

Protein Sequence

>7088 : length: 814
MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRH
YVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELN
AIIGVRGLPGLPPTQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSAGLLALSSA
LSGQSHLAIKDDKKHHDAEHHRDREPGTSNSLLVPDSLRGTDKRRNGPEFSNDIKKRKVD
DKDSSHYDSDGDKSDDNLVVDVSNEDPSSPRASPAHSPRENGIDKNRLLKKDASSSPAST
ASSASSTSLKSKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPL
VNQAGLDFHLELVPGNGKFGLKEKSWILSRKSSFEIKSAAGLRTPLAVPGPYPAPFGMVP
HAGMNGELTSPGAAYASLHNMSPQMSAAAAAAAVVAYGRSPMVGFDPPPHMRVPTIPPNL
AGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPT
RHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSI
WDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHT
DGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGM
ESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQS
KESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY