ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7080

Name

NKX2-1

Synonym

BCH|BHC|NK-2|NKX2.1|NKX2A|T/EBP|TEBP|TITF1|TTF-1|TTF1;NK2 homeobox 1;NKX2-1;NK2 homeobox 1

Definition

NK-2 homolog A|homeobox protein NK-2 homolog A|homeobox protein Nkx-2.1|thyroid nuclear factor 1|thyroid transcription factor 1|thyroid-specific enhancer-binding protein

Position

14q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

FOXA2 and FOXA3 transcription factor networks;PID Curated;200073

Disease

Height;NHGRI

Disease

Mental retardation;FunDO

Disease

Choreoathetosis, hypothyroidism, and neonatal respiratory distress;OMIM

Disease

Goiter, familial, due to TTF-1 defect;OMIM

Disease

Thyroid gland disease;FunDO

Disease

Thyroid cancer;NHGRI

Disease

thyroid cancer;GAD

Disease

CANCER;GAD

Disease

Cancer;FunDO

Disease

DEVELOPMENTAL;GAD

Disease

height;GAD

Disease

Chorea, hereditary benign;OMIM

External Links

Links to cell senescence gene database

7080

Links to epithelial mesenchymal transition gene database

7080

Links to ovarian cancer gene database

7080

Links to endometrial cancer gene database

7080

Links to iHOP

7080

Sequence Information

Nucleotide Sequence

>7080 : length: 2352
GAAACTTAAAGGTGTTTACCTTGTCATCAGCATGTAAGCTAATTATCTCGGGCAAGATGT
AGGCTTCTATTGTCTTGTTGCTTTAGCGCTTACGCCCCGCCTCTGGTGGCTGCCTAAAAC
CTGGCGCCGGGCTAAAACAAACGCGAGGCAGCCCCCGAGCCTCCACTCAAGCCAATTAAG
GAGGACTCGGTCCACTCCGTTACGTGTACATCCAACAAGATCGGCGTTAAGGTAACACCA
GAATATTTGGCAAAGGGAGAAAAAAAAAGCAGCGAGGCTTCGCCTTCCCCCTCTCCCTTT
TTTTTCCTCCTCTTCCTTCCTCCTCCAGCCGCCGCCGAATCATGTCGATGAGTCCAAAGC
ACACGACTCCGTTCTCAGTGTCTGACATCTTGAGTCCCCTGGAGGAAAGCTACAAGAAAG
TGGGCATGGAGGGCGGCGGCCTCGGGGCTCCGCTGGCGGCGTACAGGCAGGGCCAGGCGG
CACCGCCAACAGCGGCCATGCAGCAGCACGCCGTGGGGCACCACGGCGCCGTCACCGCCG
CCTACCACATGACGGCGGCGGGGGTGCCCCAGCTCTCGCACTCCGCCGTGGGGGGCTACT
GCAACGGCAACCTGGGCAACATGAGCGAGCTGCCGCCGTACCAGGACACCATGAGGAACA
GCGCCTCTGGCCCCGGATGGTACGGCGCCAACCCAGACCCGCGCTTCCCCGCCATCTCCC
GCTTCATGGGCCCGGCGAGCGGCATGAACATGAGCGGCATGGGCGGCCTGGGCTCGCTGG
GGGACGTGAGCAAGAACATGGCCCCGCTGCCAAGCGCGCCGCGCAGGAAGCGCCGGGTGC
TCTTCTCGCAGGCGCAGGTGTACGAGCTGGAGCGACGCTTCAAGCAACAGAAGTACCTGT
CGGCGCCGGAGCGCGAGCACCTGGCCAGCATGATCCACCTGACGCCCACGCAGGTCAAGA
TCTGGTTCCAGAACCACCGCTACAAAATGAAGCGCCAGGCCAAGGACAAGGCGGCGCAGC
AGCAACTGCAGCAGGACAGCGGCGGCGGCGGGGGCGGCGGGGGCACCGGGTGCCCGCAGC
AGCAACAGGCTCAGCAGCAGTCGCCGCGACGCGTGGCGGTGCCGGTCCTGGTGAAAGACG
GCAAACCGTGCCAGGCGGGTGCCCCCGCGCCGGGCGCCGCCAGCCTACAAGGCCACGCGC
AGCAGCAGGCGCAGCACCAGGCGCAGGCCGCGCAGGCGGCGGCAGCGGCCATCTCCGTGG
GCAGCGGTGGCGCCGGCCTTGGCGCACACCCGGGCCACCAGCCAGGCAGCGCAGGCCAGT
CTCCGGACCTGGCGCACCACGCCGCCAGCCCCGCGGCGCTGCAGGGCCAGGTATCCAGCC
TGTCCCACCTGAACTCCTCGGGCTCGGACTACGGCACCATGTCCTGCTCCACCTTGCTAT
ACGGTCGGACCTGGTGAGAGGACGCCGGGCCGGCCCTAGCCCAGCGCTCTGCCTCACCGC
TTCCCTCCTGCCCGCCACACAGACCACCATCCACCGCTGCTCCACGCGCTTCGACTTTTC
TTAACAACCTGGCCGCGTTTAGACCAAGGAACAAAAAAACCACAAAGGCCAAACTGCTGG
ACGTCTTTCTTTTTTTCCCCCCCTAAAATTTGTGGGTTTTTTTTTTTAAAAAAAGAAAAT
GAAAAACAACCAAGCGCATCCAATCTCAAGGAATCTTTAAGCAGAGAAGGGCATAAAACA
GCTTTGGGGTGTCTTTTTTTGGTGATTCAAATGGGTTTTCCACGCTAGGGCGGGGCACAG
ATTGGAGAGGGCTCTGTGCTGACATGGCTCTGGACTCTAAAGACCAAACTTCACTCTGGG
CACACTCTGCCAGCAAAGAGGACTCGCTTGTAAATACCAGGATTTTTTTTTTTTTTTGAA
GGGAGGACGGGAGCTGGGGAGAGGAAAGAGTCTTCAACATAACCCACTTGTCACTGACAC
AAAGGAAGTGCCCCCTCCCCGGCACCCTCTGGCCGCCTAGGCTCAGCGGCGACCGCCCTC
CGCGAAAATAGTTTGTTTAATGTGAACTTGTAGCTGTAAAACGCTGTCAAAAGTTGGACT
AAATGCCTAGTTTTTAGTAATCTGTACATTTTGTTGTAAAAAGAAAAACCACTCCCAGTC
CCCAGCCCTTCACATTTTTTATGGGCATTGACAAATCTGTGTATATTATTTGGCAGTTTG
GTATTTGCGGCGTCAGTCTTTTTCTGTTGTAACTTATGTAGATATTTGGCTTAAATATAG
TTCCTAAGAAGCTTCTAATAAATTATACAAATTAAAAAGATTCTTTTTCTGATTAAAAAA
AAAAAAAAAAAA

Protein Sequence

>7080 : length: 401
MWSGGSGKARGWEAAAGGRSSPGRLSRRRIMSMSPKHTTPFSVSDILSPLEESYKKVGME
GGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGN
LGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVS
KNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQ
NHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPC
QAGAPAPGAASLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDL
AHHAASPAALQGQVSSLSHLNSSGSDYGTMSCSTLLYGRTW