ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7067

Name

THRA

Synonym

AR7|CHNG6|EAR7|ERB-T-1|ERBA|ERBA1|NR1A1|THRA1|THRA2|c-ERBA-1;thyroid hormone receptor, alpha;THRA;thyroid hormone receptor, alpha

Definition

EAR-7|ERBA-related 7|V-erbA-related protein 7|c-erbA-alpha|nuclear receptor subfamily 1 group A member 1|thyroid hormone receptor alpha|thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian)|thyroid normone nucle

Position

17q11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

map kinase inactivation of smrt corepressor;PID BioCarta;100032

Pathway

Neuroactive ligand-receptor interaction;KEGG PATHWAY;hsa04080

Pathway

Gene Expression;Reactome;REACT:71

Disease

thyroid cancer;GAD

Disease

CANCER;GAD

External Links

Links to cell senescence gene database

7067

Links to epithelial mesenchymal transition gene database

7067

Links to ovarian cancer gene database

7067

Links to endometrial cancer gene database

7067

Links to iHOP

7067

Sequence Information

Nucleotide Sequence

>7067 : length: 2566
GGCCTGCAGGGAGCAGCCGCGAGCCGGCCGGGCGCGCCGAGCCCGAGCCCCAGCCGGAGC
GGGGCGGGGGAGGGAGGAGCCAGAGCGGCCGCCGCCTCTGCCGGAGGAGCCGCGGGGCCG
CCACACTCGCCCCCCGCCCCCCCCGCGCTCACTCGCACTCACACCCGGGCGCAGGAGGCG
GGCGGCCCGGGCCCCACCGGCCCCCCATGGACGCCCCCAGCACGGGGCGCTGAGACCCCC
GCGTCGCTGCCCAGCCCGGTCCGGCGCGCCACGCCGAGGGATCTCTGGACAGGACAAGAC
TCCGAAGCTACTCCCCCAGCACACAGCCCGGGACCCACAAACCCAGCTTGCCCCCAGCCC
TCCCACCTGCCACTCCCTGGCCCCTCCCACCGCCCGCCCCCCTTGGGGCGCAGGGCATGG
TGTGAAAGGCCAAGTGCTGAGGCGGGTATCATGGGTGCTGTGCCCTAGGGCCTGGGTGGC
AGGGGGTGGGTGGCCTGTGGGTGTGCCGGGGGGGCCAGTGTGCCCACCCCAGTCTCTTGG
CGTGCTGGAGGGCATCCTGGATGGAATTGAAGTGAATGGAACAGAAGCCAAGCAAGGTGG
AGTGTGGGTCAGACCCAGAGGAGAACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAA
AGAACGGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCTGGACA
AAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCAACTGGTTATCACTACCGCTGTATCA
CTTGTGAGGGCTGCAAGGGCTTCTTTCGCCGCACAATCCAGAAGAACCTCCATCCCACCT
ATTCCTGCAAATATGACAGCTGCTGTGTCATTGACAAGATCACCCGCAATCAGTGCCAGC
TGTGCCGCTTCAAGAAGTGCATCGCCGTGGGCATGGCCATGGACTTGGTTCTAGATGACT
CGAAGCGGGTGGCCAAGCGTAAGCTGATTGAGCAGAACCGGGAGCGGCGGCGGAAGGAGG
AGATGATCCGATCACTGCAGCAGCGACCAGAGCCCACTCCTGAAGAGTGGGATCTGATCC
ACATTGCCACAGAGGCCCATCGCAGCACCAATGCCCAGGGCAGCCATTGGAAACAGAGGC
GGAAATTCCTGCCCGATGACATTGGCCAGTCACCCATTGTCTCCATGCCGGACGGAGACA
AGGTGGACCTGGAAGCCTTCAGCGAGTTTACCAAGATCATCACCCCGGCCATCACCCGTG
TGGTGGACTTTGCCAAAAAACTGCCCATGTTCTCCGAGCTGCCTTGCGAAGACCAGATCA
TCCTCCTGAAGGGGTGCTGCATGGAGATCATGTCCCTGCGGGCGGCTGTCCGCTACGACC
CTGAGAGCGACACCCTGACGCTGAGTGGGGAGATGGCTGTCAAGCGGGAGCAGCTCAAGA
ATGGCGGCCTGGGCGTAGTCTCCGACGCCATCTTTGAACTGGGCAAGTCACTCTCTGCCT
TTAACCTGGATGACACGGAAGTGGCTCTGCTGCAGGCTGTGCTGCTAATGTCAACAGACC
GCTCGGGCCTGCTGTGTGTGGACAAGATCGAGAAGAGTCAGGAGGCGTACCTGCTGGCGT
TCGAGCACTACGTCAACCACCGCAAACACAACATTCCGCACTTCTGGCCCAAGCTGCTGA
TGAAGGAGAGAGAAGTGCAGAGTTCGATTCTGTACAAGGGGGCAGCGGCAGAAGGCCGGC
CGGGCGGGTCACTGGGCGTCCACCCGGAAGGACAGCAGCTTCTCGGAATGCATGTTGTTC
AGGGTCCGCAGGTCCGGCAGCTTGAGCAGCAGCTTGGTGAAGCGGGAAGTCTCCAAGGGC
CGGTTCTTCAGCACCAGAGCCCGAAGAGCCCGCAGCAGCGTCTCCTGGAGCTGCTCCACC
GAAGCGGAATTCTCCATGCCCGAGCGGTCTGTGGGGAAGACGACAGCAGTGAGGCGGACT
CCCCGAGCTCCTCTGAGGAGGAACCGGAGGTCTGCGAGGACCTGGCAGGCAATGCAGCCT
CTCCCTGAAGCCCCCCAGAAGGCCGATGGGGAAGGAGAAGGAGTGCCATACCTTCTCCCA
GGCCTCTGCCCCAAGAGCAGGAGGTGCCTGAAAGCTGGGAGCGTGGGCTCAGCAGGGCTG
GTCACCTCCCATCCCGTAAGACCACCTTCCCTTCCTCAGCAGGCCAAACATGGCCAGACT
CCCTTGCTTTTTGCTGTGTAGTTCCCTCTGCCTGGGATGCCCTTCCCCCTTTCTCTGCCT
GGCAACATCTTACTTGTCCTTTGAGGCCCCAACTCAAGTGTCACCTCCTTCCCCAGCTCC
CCCAGGCAGAAATAGTTGTCTGTGCTTCCTTGGTTCATGCTTCTACTGTGACACTTATCT
CACTGTTTTATAATTAGTCGGGCATGAGTCTGTTTCCCAAGCTAGACTGTGTCTGAATCA
TGTCTGTATCCCCAGTGCCCGGTGCAGGGCCTGGCATAGAGTAGGTACTCCATAAAAGGT
GTGTTGAATTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>7067 : length: 490
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKA
TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM
AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA
QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS
ELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF
ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNI
PHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQL
GEAGSLQGPVLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSEADSPSSSEEEPEVC
EDLAGNAASP