ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7053

Name

TGM3

Synonym

TGE;transglutaminase 3;TGM3;transglutaminase 3

Definition

E polypeptide, protein-glutamine-gamma-glutamyltransferase|TG(E)|TGase E|TGase-3|protein-glutamine gamma-glutamyltransferase E|transglutaminase E|transglutaminase-3

Position

20q11.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

7053

Links to epithelial mesenchymal transition gene database

7053

Links to ovarian cancer gene database

7053

Links to endometrial cancer gene database

7053

Links to iHOP

7053

Sequence Information

Nucleotide Sequence

>7053 : length: 2679
ATTCTATAAATGGTAAGGCAATCCTTGGCAGCCTGTCTGTCAGCACTGTCCGTGCCATTC
CCAGAGGAGCCTGAGAAGAGGCAGAGGAAGGCGAAACATGGCTGCTCTAGGAGTCCAGAG
TATCAACTGGCAGACGGCCTTCAACCGACAAGCGCATCACACAGACAAGTTCTCCAGCCA
GGAGCTCATCTTGCGGAGAGGCCAAAACTTCCAGGTCTTAATGATCATGAACAAAGGCCT
TGGCTCTAACGAAAGACTGGAGTTCATTGTCTCCACAGGGCCTTACCCCTCAGAGTCGGC
CATGACGAAGGCTGTGTTTCCACTCTCCAATGGCAGTAGTGGTGGCTGGAGTGCGGTGCT
TCAGGCCAGCAATGGCAATACTCTGACTATCAGCATCTCCAGTCCTGCCAGCGCACCCAT
AGGACGGTACACAATGGCCCTCCAGATCTTCTCCCAGGGCGGCATCTCCTCTGTGAAACT
TGGGACGTTCATACTGCTTTTTAACCCCTGGCTGAATGTGGATAGCGTCTTTATGGGTAA
CCACGCTGAGAGAGAAGAGTATGTTCAGGAAGATGCCGGCATCATCTTTGTGGGAAGCAC
AAACCGAATTGGCATGATTGGCTGGAACTTTGGACAGTTTGAAGAAGACATTCTCAGCAT
CTGCCTCTCAATCTTGGATAGGAGTCTGAATTTCCGCCGTGACGCTGCTACTGATGTGGC
CAGCAGAAATGACCCCAAATACGTTGGCCGGGTGCTGAGTGCCATGATCAATAGCAATGA
TGACAATGGTGTGCTTGCTGGGAATTGGAGCGGCACTTACACCGGTGGCCGGGACCCAAG
GAGCTGGAACGGCAGCGTGGAGATCCTCAAAAATTGGAAAAAATCTGGCTTCAGCCCAGT
CCGATATGGCCAGTGCTGGGTCTTTGCTGGGACCCTCAACACAGCGCTGCGGTCTTTGGG
GATTCCTTCCCGGGTGATCACCAACTTCAACTCAGCTCATGACACAGACCGAAATCTCAG
TGTGGATGTGTACTACGACCCCATGGGAAACCCCCTGGACAAGGGTAGTGATAGCGTATG
GAATTTCCATGTCTGGAATGAAGGCTGGTTTGTGAGGTCTGACCTGGGCCCCTCGTACGG
TGGATGGCAGGTGTTGGATGCTACCCCGCAGGAAAGAAGCCAAGGGGTGTTCCAGTGCGG
CCCCGCTTCGGTCATTGGTGTTCGAGAGGGTGATGTGCAGCTGAACTTCGACATGCCCTT
TATCTTCGCGGAGGTTAATGCCGACCGCATCACCTGGCTGTACGACAACACCACTGGCAA
ACAGTGGAAGAATTCCGTGAACAGTCACACCATTGGCAGGTACATCAGCACCAAGGCGGT
GGGCAGCAATGCTCGCATGGACGTCACGGACAAGTACAAGTACCCAGAAGGCTCTGACCA
GGAAAGACAAGTGTTCCAAAAGGCTTTGGGGAAACTTAAACCCAACACGCCATTTGCCGC
GACGTCTTCAATGGGTTTGGAAACAGAGGAACAGGAGCCCAGCATCATCGGGAAGCTGAA
GGTCGCTGGCATGCTGGCAGTAGGCAAAGAAGTCAACCTGGTCCTACTGCTCAAAAACCT
GAGCAGGGATACGAAGACAGTGACAGTGAACATGACAGCCTGGACCATCATCTACAACGG
CACGCTTGTACATGAAGTGTGGAAGGACTCTGCCACAATGTCCCTGGACCCTGAGGAAGA
GGCAGAACATCCCATAAAGATCTCGTACGCTCAGTATGAGAAGTACCTGAAGTCAGACAA
CATGATCCGGATCACAGCGGTGTGCAAGGTCCCAGATGAGTCTGAGGTGGTGGTGGAGCG
GGACATCATCCTGGACAACCCCACCTTGACCCTGGAGGTGCTGAACGAGGCTCGTGTGCG
GAAGCCTGTGAACGTGCAGATGCTCTTCTCCAATCCACTGGATGAGCCGGTGAGGGACTG
CGTGCTGATGGTGGAGGGAAGCGGCCTGCTGTTGGGTAACCTGAAGATCGACGTGCCGAC
CCTAGGGCCCAAGGAGGGGTCCCGGGTCCGTTTTGATATCCTGCCCTCCCGGAGTGGCAC
CAAGCAACTGCTCGCCGACTTCTCCTGCAACAAGTTCCCTGCAATCAAGGCCATGTTGTC
CATCGATGTAGCCGAATGAAGGGCGCTGGTGGCCTCCCGTACAAACTTGGACAACACGGA
GCAGGGAGAGCTCACCATGGAATGAACCCCCCGCCCATGCTGTCCGGCCTGGGAAACCCT
CTCCATCTCCCAAGGCTGCCAGACATGGACCTCCAGGCTCCAGCACATCCCCCTCTCCTC
TCCCCCAGGTTGGGGCTGGGTCCACCCTGTCCTATGACTTGATCACTTTTGCACATTCCC
TGGCCGCTTCTCCCCAGAGCTGCCTGCTCTGTGAGCCCCACAGCCCTGCTCATTCCTCAC
GCCCTTCAATGCTGCAGGATGGACTGGCCCCTGACCCAGGGACTCTCCAAACGGGATACA
GGAGAGAAGCTGGTCTAGACTGTTTGCTGATCCCCAACCTGCACGGGGCATTCCTGCTTC
TCTCTCAGGCCACCACAGAGGGCAGGGGATGGTTAGTCACCTGCCCCAGCACTCACACCC
TAACTCAAAATAAATGTTAAATAAGTGCGATCACACAAA

Protein Sequence

>7053 : length: 693
MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGSNERLEFIVST
GPYPSESAMTKAVFPLSNGSSGGWSAVLQASNGNTLTISISSPASAPIGRYTMALQIFSQ
GGISSVKLGTFILLFNPWLNVDSVFMGNHAEREEYVQEDAGIIFVGSTNRIGMIGWNFGQ
FEEDILSICLSILDRSLNFRRDAATDVASRNDPKYVGRVLSAMINSNDDNGVLAGNWSGT
YTGGRDPRSWNGSVEILKNWKKSGFSPVRYGQCWVFAGTLNTALRSLGIPSRVITNFNSA
HDTDRNLSVDVYYDPMGNPLDKGSDSVWNFHVWNEGWFVRSDLGPSYGGWQVLDATPQER
SQGVFQCGPASVIGVREGDVQLNFDMPFIFAEVNADRITWLYDNTTGKQWKNSVNSHTIG
RYISTKAVGSNARMDVTDKYKYPEGSDQERQVFQKALGKLKPNTPFAATSSMGLETEEQE
PSIIGKLKVAGMLAVGKEVNLVLLLKNLSRDTKTVTVNMTAWTIIYNGTLVHEVWKDSAT
MSLDPEEEAEHPIKISYAQYEKYLKSDNMIRITAVCKVPDESEVVVERDIILDNPTLTLE
VLNEARVRKPVNVQMLFSNPLDEPVRDCVLMVEGSGLLLGNLKIDVPTLGPKEGSRVRFD
ILPSRSGTKQLLADFSCNKFPAIKAMLSIDVAE