ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7040

Name

TGFB1

Synonym

CED|DPD1|LAP|TGFB|TGFbeta;transforming growth factor, beta 1;TGFB1;transforming growth factor, beta 1

Definition

TGF-beta-1|latency-associated peptide|prepro-transforming growth factor beta-1|transforming growth factor beta-1

Position

19q13.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

ALK1 signaling events;PID Curated;200126

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

IL12 signaling mediated by STAT4;PID Curated;200197

Pathway

cell cycle: g1/s check point;PID BioCarta;100160

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

IL27-mediated signaling events;PID Curated;200023

Pathway

Hypertrophic cardiomyopathy (HCM);KEGG PATHWAY;hsa05410

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

Malaria;KEGG PATHWAY;hsa05144

Pathway

Influenza Virus Induced Apoptosis;PID Reactome;500929

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

Intestinal immune network for IgA production;KEGG PATHWAY;hsa04672

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

Signaling by TGF beta;PID Reactome;500590

Pathway

RXR and RAR heterodimerization with other nuclear receptor;PID Curated;200112

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Influenza Infection;Reactome;REACT:6167

Pathway

Syndecan-1-mediated signaling events;PID Curated;200134

Pathway

Dilated cardiomyopathy;KEGG PATHWAY;hsa05414

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

Syndecan-2-mediated signaling events;PID Curated;200164

Pathway

Signaling by TGF beta;Reactome;REACT:6844

Disease

Glomerulonephritis, IGA;GAD

Disease

allergic rhinitis;GAD

Disease

vesicoureteral reflux;GAD

Disease

Sjogren's syndrome;GAD

Disease

HEMATOLOGICAL;GAD

Disease

radiotherapy response;GAD

Disease

ossification of the posterior longitudinal ligament;GAD

Disease

proliferative vitreoretinopathy rhegmatogenous retinal detachment;GAD

Disease

parvovirus B19 infection;GAD

Disease

cardiovascular;GAD

Disease

breast cancer;GAD

Disease

hepatitis B;GAD

Disease

rheumatic heart disease;GAD

Disease

nephropathy;GAD

Disease

radiotherapy;GAD

Disease

prostatic hyperplasia;GAD

Disease

hepatitis C;GAD

Disease

testicular cancer;GAD

Disease

lung cancer;GAD

Disease

early onset ischemic heart disease.;GAD

Disease

IMMUNE;GAD

Disease

preterm delivery;GAD

Disease

Giardiasis;GAD

Disease

duodenal ulcer gastric ulcer;GAD

Disease

prostate cancer;GAD

Disease

pancreatitis, chronic;GAD

Disease

Asthma;GAD

Disease

blood pressure;GAD

Disease

periodontitis;GAD

Disease

prevalent vertebral fractures;GAD

Disease

Allograft rejection;KEGG DISEASE;H00083

Disease

Cystic fibrosis lung disease, modifier of;OMIM

Disease

INFECTION;GAD

Disease

Constriction, Pathologic;GAD

Disease

Bone Mineral Density;GAD

Disease

METABOLIC;GAD

Disease

bone density;GAD

Disease

radiation-induced damage to normal tissues;GAD

Disease

heart transplant complications;GAD

Disease

REPRODUCTION;GAD

Disease

CARDIOVASCULAR;GAD

Disease

cystic fibrosis;GAD

Disease

CANCER;GAD

Disease

Myocardial Infarction;GAD

Disease

HIV Infections;GAD

Disease

NEUROLOGICAL;GAD

Disease

VISION;GAD

Disease

Asthma severity;GAD

Disease

very low bone mass;GAD

Disease

atopic dermatitis;GAD

Disease

Graft-versus-host disease;KEGG DISEASE;H00084

Disease

allograft outcome;GAD

Disease

leukemia;GAD

Disease

idiopathic pulmonary fibrosis;GAD

Disease

Immune system diseases;KEGG DISEASE

Disease

Osteoporosis;GAD

Disease

Camurati-Engelmann disease;OMIM

Disease

Allergies and autoimmune diseases;KEGG DISEASE

Disease

increased incidence of invasive breast cancer;GAD

Disease

Migraine Disorders;GAD

Disease

Graft vs Host Disease;GAD

Disease

Pneumoconiosis;GAD

Disease

stomach cancer;GAD

Disease

chronic idiopathic neutropenia;GAD

Disease

RENAL;GAD

External Links

Links to cell senescence gene database

7040

Links to epithelial mesenchymal transition gene database

7040

Links to ovarian cancer gene database

7040

Links to endometrial cancer gene database

7040

Links to iHOP

7040

Sequence Information

Nucleotide Sequence

>7040 : length: 2583
AGCCGGTCCCCGCCGCCGCCGCCCTTCGCGCCCTGGGCCATCTCCCTCCCACCTCCCTCC
GCGGAGCAGCCAGACAGCGAGGGCCCCGGCCGGGGGCAGGGGGGACGCCCCGTCCGGGGC
ACCCCCCCGGCTCTGAGCCGCCCGCGGGGCCGGCCTCGGCCCGGAGCGGAGGAAGGAGTC
GCCGAGGAGCAGCCTGAGGCCCCAGAGTCTGAGACGAGCCGCCGCCGCCCCCGCCACTGC
GGGGAGGAGGGGGAGGAGGAGCGGGAGGAGGGACGAGCTGGTCGGGAGAAGAGGAAAAAA
ACTTTTGAGACTTTTCCGTTGCCGCTGGGAGCCGGAGGCGCGGGGACCTCTTGGCGCGAC
GCTGCCCCGCGAGGAGGCAGGACTTGGGGACCCCAGACCGCCTCCCTTTGCCGCCGGGGA
CGCTTGCTCCCTCCCTGCCCCCTACACGGCGTCCCTCAGGCGCCCCCATTCCGGACCAGC
CCTCGGGAGTCGCCGACCCGGCCTCCCGCAAAGACTTTTCCCCAGACCTCGGGCGCACCC
CCTGCACGCCGCCTTCATCCCCGGCCTGTCTCCTGAGCCCCCGCGCATCCTAGACCCTTT
CTCCTCCAGGAGACGGATCTCTCTCCGACCTGCCACAGATCCCCTATTCAAGACCACCCA
CCTTCTGGTACCAGATCGCGCCCATCTAGGTTATTTCCGTGGGATACTGAGACACCCCCG
GTCCAAGCCTCCCCTCCACCACTGCGCCCTTCTCCCTGAGGACCTCAGCTTTCCCTCGAG
GCCCTCCTACCTTTTGCCGGGAGACCCCCAGCCCCTGCAGGGGCGGGGCCTCCCCACCAC
ACCAGCCCTGTTCGCGCTCTCGGCAGTGCCGGGGGGCGCCGCCTCCCCCATGCCGCCCTC
CGGGCTGCGGCTGCTGCCGCTGCTGCTACCGCTGCTGTGGCTACTGGTGCTGACGCCTGG
CCGGCCGGCCGCGGGACTATCCACCTGCAAGACTATCGACATGGAGCTGGTGAAGCGGAA
GCGCATCGAGGCCATCCGCGGCCAGATCCTGTCCAAGCTGCGGCTCGCCAGCCCCCCGAG
CCAGGGGGAGGTGCCGCCCGGCCCGCTGCCCGAGGCCGTGCTCGCCCTGTACAACAGCAC
CCGCGACCGGGTGGCCGGGGAGAGTGCAGAACCGGAGCCCGAGCCTGAGGCCGACTACTA
CGCCAAGGAGGTCACCCGCGTGCTAATGGTGGAAACCCACAACGAAATCTATGACAAGTT
CAAGCAGAGTACACACAGCATATATATGTTCTTCAACACATCAGAGCTCCGAGAAGCGGT
ACCTGAACCCGTGTTGCTCTCCCGGGCAGAGCTGCGTCTGCTGAGGCTCAAGTTAAAAGT
GGAGCAGCACGTGGAGCTGTACCAGAAATACAGCAACAATTCCTGGCGATACCTCAGCAA
CCGGCTGCTGGCACCCAGCGACTCGCCAGAGTGGTTATCTTTTGATGTCACCGGAGTTGT
GCGGCAGTGGTTGAGCCGTGGAGGGGAAATTGAGGGCTTTCGCCTTAGCGCCCACTGCTC
CTGTGACAGCAGGGATAACACACTGCAAGTGGACATCAACGGGTTCACTACCGGCCGCCG
AGGTGACCTGGCCACCATTCATGGCATGAACCGGCCTTTCCTGCTTCTCATGGCCACCCC
GCTGGAGAGGGCCCAGCATCTGCAAAGCTCCCGGCACCGCCGAGCCCTGGACACCAACTA
TTGCTTCAGCTCCACGGAGAAGAACTGCTGCGTGCGGCAGCTGTACATTGACTTCCGCAA
GGACCTCGGCTGGAAGTGGATCCACGAGCCCAAGGGCTACCATGCCAACTTCTGCCTCGG
GCCCTGCCCCTACATTTGGAGCCTGGACACGCAGTACAGCAAGGTCCTGGCCCTGTACAA
CCAGCATAACCCGGGCGCCTCGGCGGCGCCGTGCTGCGTGCCGCAGGCGCTGGAGCCGCT
GCCCATCGTGTACTACGTGGGCCGCAAGCCCAAGGTGGAGCAGCTGTCCAACATGATCGT
GCGCTCCTGCAAGTGCAGCTGAGGTCCCGCCCCGCCCCGCCCCGCCCCGGCAGGCCCGGC
CCCACCCCGCCCCGCCCCCGCTGCCTTGCCCATGGGGGCTGTATTTAAGGACACCCGTGC
CCCAAGCCCACCTGGGGCCCCATTAAAGATGGAGAGAGGACTGCGGATCTCTGTGTCATT
GGGCGCCTGCCTGGGGTCTCCATCCCTGACGTTCCCCCACTCCCACTCCCTCTCTCTCCC
TCTCTGCCTCCTCCTGCCTGTCTGCACTATTCCTTTGCCCGGCATCAAGGCACAGGGGAC
CAGTGGGGAACACTACTGTAGTTAGATCTATTTATTGAGCACCTTGGGCACTGTTGAAGT
GCCTTACATTAATGAACTCATTCAGTCACCATAGCAACACTCTGAGATGCAGGGACTCTG
ATAACACCCATTTTAAAGGTGAGGAAACAAGCCCAGAGAGGTTAAGGGAGGAGTTCCTGC
CCACCAGGAACCTGCTTTAGTGGGGGATAGTGAAGAAGACAATAAAAGATAGTAGTTCAG
GCC

Protein Sequence

>7040 : length: 391
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINAGF
TTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLY
IDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQ
ALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS