ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7030

Name

TFE3

Synonym

RCCP2|RCCX1|TFEA|bHLHe33;transcription factor binding to IGHM enhancer 3;TFE3;transcription factor binding to IGHM enhancer 3

Definition

class E basic helix-loop-helix protein 33|transcription factor E family, member A|transcription factor E3|transcription factor for IgH enhancer|transcription factor for immunoglobulin heavy-chain enhancer 3

Position

Xp11.22

Gene Type

protein-coding

Pathways and Diseases

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Disease

Alveolar soft part sarcoma;KEGG DISEASE;H00051

Disease

Cancers;KEGG DISEASE

Disease

Cancers of soft tissues and bone;KEGG DISEASE

Disease

Renal cell carcinoma, papillary, 1;OMIM

External Links

Links to cell senescence gene database

7030

Links to epithelial mesenchymal transition gene database

7030

Links to ovarian cancer gene database

7030

Links to endometrial cancer gene database

7030

Links to iHOP

7030

Sequence Information

Nucleotide Sequence

>7030 : length: 3497
TTCCTGTGGAGTTTCCCCATCCCTGGGAGGAGGGAGGAGGGGGAAGAAGACGAGGGGGAG
GAGGGCGGTCGTCCGGGGTTAGGTTGAGGGGGGGCGTCGGTCCGTTCTGGGCGGGGGATG
ACTCACAGCCCATCCCATCTCCCCGACGCCGCCCGCCCGCGCAGTGCTAGCTCCATGGCT
TAGCGGAGGAGGCGGCGGTGGCGAGCTGGGGGGAGGGGGGACTCTTATTTTGTTAGGGGG
ACCGGGCCGAGGCCCGACCGGCCTGGCAGGGCTCGCCCGGGGCCGGGCGTCATGTCTCAT
GCGGCCGAACCAGCTCGGGATGGCGTAGAGGCCAGCGCGGAGGGCCCTCGAGCCGTGTTC
GTGCTGTTGGAGGAGCGCAGGCCGGCCGACTCGGCTCAGCTGCTCAGCCTGAACTCTTTG
CTTCCGGAATCCGGGATTGTTGCTGACATAGAATTAGAAAACGTCCTTGATCCTGACAGC
TTCTACGAGCTCAAAAGCCAACCCTTACCCCTTCGCTCAAGCCTCCCAATATCACTGCAG
GCCACACCAGCCACCCCAGCTACACTCTCTGCATCGTCTTCTGCAGGGGGCTCCAGGACC
CCTGCCATGTCGTCATCTTCTTCATCGAGGGTCTTGCTGCGGCAGCAGCTAATGCGGGCC
CAGGCGCAGGAGCAGGAGAGGCGTGAGCGTCGGGAACAGGCCGCCGCGGCTCCCTTCCCC
AGTCCTGCACCTGCCTCTCCTGCCATCTCTGTGGTTGGCGTCTCTGCTGGGGGCCACACA
TTGAGCCGTCCACCCCCTGCTCAGGTGCCCAGGGAGGTGCTCAAGGTGCAGACCCATCTG
GAGAACCCAACGCGCTACCACCTGCAGCAGGCGCGCCGGCAGCAGGTGAAACAGTACCTG
TCCACCACACTCGGGCCCAAGCTGGCTTCCCAGGCCCTCACCCCACCGCCGGGGCCCGCA
AGTGCCCAGCCACTGCCTGCCCCTGAGGCTGCCCACACTACCGGCCCCACAGGCAGTGCG
CCCAACAGCCCCATGGCGCTGCTCACCATCGGGTCCAGCTCAGAGAAGGAGATTGATGAT
GTCATTGATGAGATCATCAGCCTGGAGTCCAGTTACAATGATGAAATGCTCAGCTATCTG
CCCGGAGGCACCACAGGACTGCAGCTCCCCAGCACGCTGCCTGTGTCAGGGAATCTGCTT
GATGTGTACAGTAGTCAAGGCGTGGCCACACCAGCCATCACTGTCAGCAACTCCTGCCCA
GCTGAGCTGCCCAACATCAAACGGGAGATCTCTGAGACCGAGGCAAAGGCCCTTTTGAAG
GAACGGCAGAAGAAAGACAATCACAACCTAATTGAGCGTCGCAGGCGATTCAACATTAAC
GACAGGATCAAGGAACTGGGCACTCTCATCCCTAAGTCCAGTGACCCATGGAGTCTCACG
CTGTCACCCAGGCTGGAGTGCAGTGGTGCAATGGGAGATGCGCTGGAACAAGGGCACCAT
CCTGAAGGCCTCTGTGGATTATATCCGCAAGCTGCAGAAGGAGCAGCAGCGCTCCAAAGA
CCTGGAGAGCCGGCAGCGATCCCTGGAGCAGGCCAACCGCAGCCTGCAGCTCCGAATTCA
GGAACTAGAACTGCAGGCCCAGATCCATGGCCTGCCAGTACCTCCCACTCCAGGGCTGCT
TTCCTTGGCCACGACTTCGGCTTCTGACAGCCTCAAGCCAGAGCAGCTGGACATTGAGGA
GGAGGGCAGGCCAGGCGCAGCAACGTTCCATGTAGGGGGGGGACCTGCCCAGAATGCTCC
CCATCAGCAGCCCCCTGCACCGCCCTCAGATGCCCTTCTGGACCTGCACTTTCCCAGCGA
CCACCTGGGGGACCTGGGAGACCCCTTCCACCTGGGGCTGGAGGACATTCTGATGGAGGA
GGAGGAGGGGGTGGTGGGAGGACTGTCGGGGGGTGCCCTGTCCCCACTGCGGGCTGCCTC
CGATCCCCTGCTCTCTTCAGTGTCCCCTGCTGTCTCCAAGGCCAGCAGCCGCCGCAGCAG
CTTCAGCATGGAAGAGGAGTCCTGATCAGGCCTCACCCCTCCCCTGGGACTTTCCCACCC
AGGAAAGGAGGACCAGTCAGGATGAGGCCCCGCCTTTTCCCCCACCCTCCCATGAGACTG
CCCTGCCCAGGTATCCTGGGGGAAGAGGAGATGTGATCAGGCCCCACCCCTGTAATCAGG
CAAGGAGGAGGAGTCAGATGAGGCCCTGCACCTTCCCCAAAGGAACCGCCCAGTGCAGGT
ATTTCAGAAGGAGAAGGCTGGAGAAGGACATGAGATCAGGGCCTGCCCCCTGGGGATCAC
AGCCTCACCCCTGCCCCTGTGGGACTCATCCTTGCCCAGGTGAGGGAAGGAGACAGGATG
AGGTCTCGACCCTGTCCCCTAGGGACTGTCCTAGCCAGGTCTCCTGGGAAAGGGAGATGT
CAGGATGTTGCTCCATCCTTTGTCTTGGAACCACCAGTCTAGTCCGTCCTGGCACAGAAG
AGGAGTCAAGTAATGGAGGTCCCAGCCCTGGGGGTTTAAGCTCTGCCCCTTCCCCATGAA
CCCTGCCCTGCTCTGCCCAGGCAAGGAACAGAAGTGAGGATGAGACCCAGCCCCTTCCCC
TGGGAACTCTCCTGGCCTTCTAGGAATGGAGGAGCCAGGCCCCACCCCTTCCCTATAGGA
ACAGCCCAGCACAGGTATTTCAGGTGTGAAAGAATCAGTAGGACCAGGCCACCGCTAGTG
CTTGTGGAGATCACAGCCCCACCCTTGTCCCTCAGCAACATCCCATCTAAGCATTCCACA
CTGCAGGGAGGAGTGGTACTTAAGCTCCCCTGCCTTAACCTGGGACCAACCTGACCTAAC
CTAGGAGGGCTCTGAGCCAACCTTGCTCTTGGGGAAGGGGACAGATTATGAAATTTCATG
GATGAATTTTCCAGACCTATATCTGGAGTGAGAGGCCCCCACCCTTGGGCAGAGTCCTGC
CTTCTTCCTTGAGGGGCAGTTTGGGAAGGTGATGGGTATTAGTGGGGGACTGAGTTCAGG
TTACCAGAACCAGTACCTCAGTATTCTTTTTCAACATGTAGGGCAAGAGGATGAAGGAAG
GGGCTATCCTGGGACCTCCCCAGCCCAGGAAAAACTGGAAGCCTTCCCCCAGCAAGGCAG
AAGCTTGGAGGAGGGTTGTAAAAGCATATTGTACCCCCTCATTTGTTTATCTGATTTTTT
TATTGCTCCGCATACTGAGAATCTAGGCCACCCCAACCTCTGTTCCCCACCCAGTTCTTC
ATTTGGAGGAATCACCCCATTTCAGAGTTATCAAGAGACACTCCCCCCTCCATTCCCACC
CCTCATACCTACACCCAAGGTTGTCAGCTTTGGATTGCTGGGGCCAGGCCCCATGGAGGG
TATACTGAGGGGTCTATAGGTTTGTGATTAAAATAATAAAAGCTAGGCGTGTTTGATGCG
CTTTTAACTTTGGCAAA

Protein Sequence

>7030 : length: 575
MSHAAEPARDGVEASAEGPRAVFVLLEERRPADSAQLLSLNSLLPESGIVADIELENVLD
PDSFYELKSQPLPLRSSLPISLQATPATPATLSASSSAGGSRTPAMSSSSSSRVLLRQQL
MRAQAQEQERRERREQAAAAPFPSPAPASPAISVVGVSAGGHTLSRPPPAQVPREVLKVQ
THLENPTRYHLQQARRQQVKQYLSTTLGPKLASQALTPPPGPASAQPLPAPEAAHTTGPT
GSAPNSPMALLTIGSSSEKEIDDVIDEIISLESSYNDEMLSYLPGGTTGLQLPSTLPVSG
NLLDVYSSQGVATPAITVSNSCPAELPNIKREISETEAKALLKERQKKDNHNLIERRRRF
NINDRIKELGTLIPKSSDPEMRWNKGTILKASVDYIRKLQKEQQRSKDLESRQRSLEQAN
RSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVG
GGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGA
LSPLRAASDPLLSSVSPAVSKASSRRSSFSMEEES