ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7024

Name

TFCP2

Synonym

LBP1C|LSF|LSF1D|SEF|TFCP2C;transcription factor CP2;TFCP2;transcription factor CP2

Definition

SAA3 enhancer factor|alpha-globin transcription factor CP2

Position

12q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by HDAC Class I;PID Curated;200070

Disease

Alzheimer's disease;GAD

Disease

Alzheimer's disease depressive disorder, major;GAD

Disease

NEUROLOGICAL;GAD

External Links

Links to cell senescence gene database

7024

Links to epithelial mesenchymal transition gene database

7024

Links to ovarian cancer gene database

7024

Links to endometrial cancer gene database

7024

Links to iHOP

7024

Sequence Information

Nucleotide Sequence

>7024 : length: 3715
GACGTCATGTTCGCCGGGCAGGCGAGGAAAGAGGACGCCATGATTGGTTGGCGCTGGGGC
GGCGGACGGTGGAAGGGCCTGGCGAGTCTAGGTTTTACGCCTGTGCTGGACTTTCTCCTT
CCATGTTTCCAGGCCGTGGGGGGCTACAGAGGGCGAGAAGTCGGCTCAGCGGAAACCTGG
ATTTGGTTCTAAGCCGTGGGGTTGAGAAGGGGTGACCGGAAGTGATCGTGGGACTGACCG
GAAGCGAGGCCTGGAGGGGAAAGAGAGAGCGAGACCTGGGAGGGAGGGGGCCTCCAGCAG
AAAGGGGCGGGGGAAAAGGTGCAAAAGCAGCGTGGGAGCGCCGGGCTGGCTTCCTGCGGC
TGCTGCTGGTCTGACTGGGAAGCAGCAAGCCACCACTACGAACTCTCAAGAGGAGTGGGA
GTGCGGGAGTCCAGAGCTGCCTCTGGGAAGTCTGCAGTAGTTGAGCAAAGGGGTCCTCAC
GTTCCTGAGAGCTGGGCAGGGGGGATTTTGGAACCTGGGGCAGCCAAGAACGAGCAGCCA
AGGGTACGGGAGATTAGTTGTGCACAGAGCAGTGCTGGTCGGGCTTGGGGGTGGCTGGTG
GGCACTGCGTGGGAAACCTTGGTTTGTAGTTTTCTTGGTTTGCGTTACTCCTGTTGGGTA
GAATTACCCTCCGCGCCTTTGTACAAGACACGGTGTCTCCTGGGGCAAGGAAGGAGCCAG
GATGGCCTGGGCTCTGAAGCTGCCTCTGGCCGACGAAGTGATTGAATCCGGGTTGGTGCA
GGACTTTGATGCTAGCCTGTCCGGGATCGGCCAGGAACTGGGTGCTGGTGCCTATAGCAT
GAGTGATGTCCTTGCATTGCCCATTTTTAAGCAAGAAGAGTCGAGTTTGCCTCCTGATAA
TGAGAATAAAATCCTGCCTTTTCAATATGTGCTTTGTGCTGCTACCTCTCCAGCAGTGAA
ACTCCATGATGAAACCCTAACGTATCTCAATCAAGGACAGTCTTATGAAATTCGAATGCT
AGACAATAGGAAACTTGGAGAACTTCCAGAAATTAATGGCAAATTGGTGAAGAGTATATT
CCGTGTGGTGTTCCATGACAGAAGGCTTCAGTACACTGAGCATCAGCAGCTAGAGGGCTG
GAGGTGGAACCGACCTGGAGACAGAATTCTTGACATAGATATCCCGATGTCTGTGGGTAT
AATCGATCCTAGGGCTAATCCAACTCAACTAAATACAGTGGAGTTCCTGTGGGACCCTGC
AAAGAGGACATCTGTGTTTATTCAGGTGCACTGTATTAGCACAGAGTTCACTATGAGGAA
ACATGGTGGAGAAAAGGGGGTGCCATTCCGAGTACAAATAGATACCTTCAAGGAGAATGA
AAACGGGGAATATACTGAGCACTTACACTCGGCCAGCTGCCAGATCAAAGTTTTCAAGCC
CAAAGGTGCAGACAGAAAGCAAAAAACGGATAGGGAAAAAATGGAGAAACGAACACCTCA
TGAAAAGGAGAAATATCAGCCTTCCTATGAGACAACCATACTCACAGAGTGTTCTCCATG
GCCCGAGATCACGTATGTCAATAACTCCCCATCACCTGGCTTCAACAGTTCCCATAGCAG
TTTTTCTCTTGGGGAAGGAAATGGTTCACCAAACCACCAGCCAGAGCCACCCCCTCCAGT
CACAGATAACCTCTTACCAACAACCACACCTCAGGAAGCTCAGCAGTGGTTGCATCGAAA
TCGTTTTTCTACATTCACAAGGCTTTTCACAAACTTCTCAGGGGCAGATTTATTGAAATT
AACTAGAGATGATGTGATCCAAATCTGTGGCCCTGCAGATGGAATCAGACTTTTTAATGC
ATTAAAAGGCCGGATGGTGCGTCCAAGGTTAACCATTTATGTTTGTCAGGAATCACTGCA
GTTGAGGGAGCAGCAACAACAGCAGCAGCAACAGCAGCAGAAGCATGAGGATGGAGACTC
AAATGGTACTTTCTTCGTTTACCATGCTATCTATCTAGAAGAACTAACAGCTGTTGAATT
GACAGAAAAAATTGCTCAGCTTTTCAGCATTTCCCCTTGCCAGATCAGCCAGATTTACAA
GCAGGGGCCAACAGGAATTCATGTGCTCATCAGTGATGAGATGATACAGAACTTTCAGGA
AGAAGCATGTTTTATTCTGGACACAATGAAAGCAGAAACCAATGATAGCTATCATATCAT
ACTGAAGTAGGAGTGCGGCGTTTCGTGCCCAGTGGCTGCTCCTTCCTTCACCTCTGAAAA
CGGCCCTCTTGAAGGGGGATATGAATGGAGATTTGAAGGTCTGCAAGAACCTGACTCGTC
TGACTGTGTGTGGAGGAGTCCAGGCCATGGAGGCAGAATCCTGGCCCTCTGTGTTGGCCC
AAGCTCTTGTGGTACACACAGATTACTGCCCAATATGCAGTTCTGCAGCTGTTTTAGTTA
AATTTCTGGACCTTGTTGTTGTTAAATATCAGTAGAAACTCTACATAATTTAGAGTGTAT
GTAGGGCATAATGATGATGGGAATTGTGTGATGTTTAACAGGAAGATCTTAAATTTTGTG
ATATGGAGCCCTGTAATTTTTTTCTTATATAAAAATGGGTATCTATATTCATAAGACTAG
GTCTTCAATCTCTTTGTACTGGTCTCAAATGTACTGGTATCTCTGCTTTTTGCCACAGTT
TGTCCCTGAAAACTTTATCAGTGAGGAGAAATACAGAATTTTCCTTTTGGTTCCCCTGTA
ATACCACAACTAATAGTATTTTCAGCTAACATTTATTGACCAGGCAGTGTGATAAATTTT
TTGAATGACCATCTTGTTTAACCCCCTAATCACACTATCTGAAGTAGGTGCTATAGTGAC
CCCCAACCGAAGATGAGGAAATGGAGACACACAGTGGCTAAGTAGCTTGCTAGGTGCCAG
GAGCTGGCAGGCAGTGATGCTGAAATCCAAACCAGGCAATCTGGCCCTCCTTATTCACCC
TCTCATACCACCAGTGCTACCCATTATAACCTGTGTTCACTTCGCTTATTACTGTGGCCC
TTCTGGTGACTACAACATAACACTGAGTATGAACTGAGGAATTAACCACTGAAAGAGACA
AAGCACACCTAAATAATGATGAACAAATCAAGACCTACAAGAAATGAACACATAGATGCT
TTTTAAGTGTCATTAGTTATCGGAATCAAAGAATTTGAGGTGGTGACAACTGGGGATTAT
CTGTAACTCCCCAAATTTACTGTTCTTGAATGACATTCTCAAACTATTTATTAATGAGTT
AGTCTCATCCCTGCTTTCTGTTTCCTCTCTCTGCATCTTCTCTTGGCATAGGAAGTTATT
TTACTCATGCTATGTTTTTTAATAGAAGCTTTACAAAAAAAGATGCATTCCCTTCCTGTT
CACACTCTTACCATGTTTTTGTTCTTCCTTAAGAATGATTGTGTGTGTGTGTGTGTGTGT
GTGTAAGTGTGTAAGTGTAACATCATGGGTTTTCTTTCTTCACTTGTAAAGTTTTATCTA
GAAATACTTTTACAGGTTATGTTGAGGTACACAAAGATAATGTTCTAAGATTGTGTATTG
GATTTGGATTTGTGTGTGTGTGTGTGTGTGTGTGTGTTTAAAGCATTTGATAAGGTTTAA
ATGTTTTTTATACAGAGATTTTTGTTCATTAAACTCAATCTGCATCATGGTCTAA

Protein Sequence

>7024 : length: 502
MAWALKLPLADEVIESGLVQDFDASLSGIGQELGAGAYSMSDVLALPIFKQEESSLPPDN
ENKILPFQYVLCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKLGELPEINGKLVKSIF
RVVFHDRRLQYTEHQQLEGWRWNRPGDRILDIDIPMSVGIIDPRANPTQLNTVEFLWDPA
KRTSVFIQVHCISTEFTMRKHGGEKGVPFRVQIDTFKENENGEYTEHLHSASCQIKVFKP
KGADRKQKTDREKMEKRTPHEKEKYQPSYETTILTECSPWPEITYVNNSPSPGFNSSHSS
FSLGEGNGSPNHQPEPPPPVTDNLLPTTTPQEAQQWLHRNRFSTFTRLFTNFSGADLLKL
TRDDVIQICGPADGIRLFNALKGRMVRPRLTIYVCQESLQLREQQQQQQQQQQKHEDGDS
NGTFFVYHAIYLEELTAVELTEKIAQLFSISPCQISQIYKQGPTGIHVLISDEMIQNFQE
EACFILDTMKAETNDSYHIILK