ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7006

Name

TEC

Synonym

PSCTK4;tec protein tyrosine kinase;TEC;tec protein tyrosine kinase

Definition

tyrosine-protein kinase Tec

Position

4p12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by Stem cell factor receptor (c-Kit);PID Curated;200156

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

EPO signaling pathway;PID Curated;200157

External Links

Links to cell senescence gene database

7006

Links to epithelial mesenchymal transition gene database

7006

Links to ovarian cancer gene database

7006

Links to endometrial cancer gene database

7006

Links to iHOP

7006

Sequence Information

Nucleotide Sequence

>7006 : length: 3639
ATCGCCCTTAAACTACAAAGAGAGACTTTTTGTACTTACAAAGTCCATGCTAACCTACTA
TGAGGGTCGAGCAGAGCCACTGTTGTGGCTCTTGTCTGACCCATGTCCAGCTTACACCTG
CCTGACCATCGCCCTGGCGCCGGGAGCCTGACTTGATATTCCCCCCAGGATCCCTGGGAA
AGCATGGCCTGAGGCAGCTGCAGCCACTGGTTCTTCAGATGAAAAGTGGAAACTCAATAC
ATCACCAGAAGAAATACAGAAAGGGGTTTATTGATGTTTCAAAAATCAAGTGTGTGGAAA
TAGTGAAGAATGATGATGGTGTCATTCCCTGTCAAAATAAGTATCCATTTCAGGTTGTTC
ATGATGCTAACACACTTTACATTTTTGCACCTAGTCCACAAAGCAGGGACCTGTGGGTGA
AGAAGTTAAAAGAAGAAATAAAGAACAACAATAATATTATGATTAAATATCATCCTAAAT
TCTGGACAGATGGAAGTTATCAGTGTTGTAGACAAACTGAAAAATTAGCACCCGGATGTG
AAAAATACAATCTTTTTGAGAGCAGTATAAGAAAAGCACTACCTCCAGCACCAGAAACAA
AGAAGCGAAGGCCTCCCCCACCAATTCCACTAGAAGAAGAAGATAATAGTGAAGAAATCG
TTGTAGCCATGTATGATTTCCAAGCAGCAGAAGGACATGATCTCAGATTAGAGAGAGGCC
AAGAGTATCTCATTTTAGAAAAGAATGATGTTCATTGGTGGAGAGCAAGAGATAAATATG
GGAATGAAGGATATATCCCAAGTAATTACGTAACGGGAAAGAAATCAAACAACTTAGATC
AATATGAATGGTATTGCAGAAATATGAATAGAAGCAAGGCAGAGCAACTCCTCCGCAGTG
AAGATAAAGAAGGTGGTTTTATGGTAAGGGATTCCAGTCAACCAGGCTTGTACACAGTCT
CCCTTTATACCAAGTTTGGAGGAGAAGGTTCATCGGGTTTTAGGCATTATCATATAAAGG
AAACAACAACATCTCCAAAGAAGTATTACCTAGCTGAAAAACATGCTTTTGGCTCCATTC
CTGAGATTATTGAATATCATAAGCACAATGCAGCAGGACTTGTCACCAGGCTTCGGTACC
CAGTTAGTGTGAAAGGGAAGAATGCACCCACCACTGCAGGATTCAGCTATGAGAAATGGG
AGATTAACCCTTCAGAACTGACCTTTATGAGGGAATTGGGAAGTGGACTGTTTGGAGTGG
TGAGGCTTGGCAAATGGCGAGCCCAGTACAAAGTCGCAATCAAAGCTATTCGGGAAGGTG
CAATGTGCGAGGAGGACTTTATAGAAGAAGCTAAAGTGATGATGAAACTGACACACCCGA
AGTTAGTGCAGCTTTATGGTGTGTGCACCCAGCAGAAACCAATATACATTGTTACTGAGT
TCATGGAAAGGGGCTGCCTTCTGAATTTCCTCCGACAGAGACAAGGTCATTTCAGTAGAG
ACGTACTGCTGAGCATGTGTCAGGATGTGTGTGAAGGGATGGAGTATCTGGAGAGAAACA
GCTTCATCCACAGAGATCTGGCTGCCAGAAATTGTCTAGTAAGTGAGGCGGGAGTTGTAA
AAGTATCTGATTTTGGAATGGCCAGGTATGTTCTGGATGATCAGTACACAAGTTCTTCTG
GTGCTAAGTTTCCTGTGAAGTGGTGTCCACCTGAAGTGTTTAATTACAGCCGCTTCAGCA
GCAAATCAGATGTCTGGTCATTTGGTGTTTTAATGTGGGAAGTATTCACGGAAGGCAGAA
TGCCTTTTGAAAAATACACCAATTATGAAGTGGTAACCATGGTTACTCGAGGCCACCGAC
TCTACCAGCCGAAGTTGGCGTCCAACTATGTGTATGAGGTGATGCTGAGATGTTGGCAGG
AGAAACCAGAGGGAAGGCCTTCTTTCGAAGATCTGCTGCGCACAATAGATGAACTAGTTG
AATGTGAAGAAACTTTTGGAAGATAAGTGATGTGTGACCAGTGGCTCCCAGATTCCCAAG
CACAAGGAAGGATGGGCATTTTGTGGCTTTTAATTTATTGAGCACTTGGACATGTAGATC
ATTTTACTTATACAGTGGAAACACATAAATAATTTGCTTCTAGACCAGCCTCTGTCTAGA
CTTGCTTCTAGACAGAATCTCCCAGAGTGTGGAAATGTTGCCTTAGAAATGGTGATTAAA
ATCACTCATTTCTATTCATTCCTCAGGCACTTGAGTGACAGTTGTTTACCAGGCACTGTG
TGTAGCCCCAGGGTTTGGCCATTCAGGGGTGCACACATGGGACCATGTTAGCTGATGCCA
GTTGAAGGCCAGGGTATTTGGGAAGGGGAAGGGTATTAGAGTCATGACCAAGCAACCCTT
CTTTTTCCCTTTGACTTCTACAGAAATCTGGGCCTGAGACATTGTCTACAATTGGGTTCT
AGATACATCAGGAACCCATCTTGGATAAATAAATACCTATCTTTTGTTTTGAAAACATCT
CAGTTTTCAAGACTGCTCTTAGTATTACATGAACAATATTTGTATGCTGTATATATTGTA
AATATATATAATATATAAAGTTATATATTTATGAGAAACACGAATTGTCTTTTAATTGAA
ACTTTTAATCCTGTAGTATAGGAGTTCACCTTCTTAGGACTAGAGACTGTGCCTTATAGC
TGTTAATTCATTTCCCCCTGAACATCAAATATGCCTGAAGAGAAGAAAGTCTAGATTCTT
CTATGAGTAACGCCCCCTCCTCACTCAGGTAAATGTGTCTGGGGATGCCTGTCCAGCTTA
ACCACGTGCATTTGGCCTATGTAATCCTGCCCATGGTGGCCGCAGCTAATCAGAATCAGA
TGGAAAATTAAACCGGGTAATCTACTTCTAAGCCTTAAGAATATTCCCTGGGACACAGAC
ACTATAATTGGAAGTGCTGAGCTCTGGGGCAGAAGGATCAGGTGACCTTCGCAACAAAGT
TTGCCCCCACCTCACATAGGACCCGGAAGCAGCCTGAGCTGTGGCGGAGGATCCAGGAAG
CTACGGAGAGAAGCAGCCAGCATGGTGTTCCGTGCCTCCCGGACGTTTTTCAGGAGGCCT
GGTTGGACTTGGGTTCCTGGATGGTGGGATTGTTGTACAGCCTCTCAGGAGACCCTGCTG
TCAAGACTGTGTGTGTGGATTTCTCACCCTTAGAAGCTCTACTAAGACATCAACGGAATT
AGGGCCTTCCTTTTTGCCTTGTGAGCGCCAAGGAAAAGAAACTATCTCGGTCACGTGAGC
GCCAGCGAAAAGAAACTGTATCAGTCATCCAGAGACCGTTTATTGCCCAACACGTTATTC
TTGCTGTTGGTGGGGTAACTAGCCGAGGAAGACACAGCGCCTTCCCTTCAGGAGTTGCGT
CTCCTCTGCAGGCCACGATGGTCTGCTCTGGAGCATTGGGTGAACACACAGGCTGGCTGC
TCTGGGCAGCGCCTTCACTCTGACCCTGGAGAACCATTTCATTTCATCCTGGTCAGTCTA
GAGTCTGTGCACCAGGCAGTCCATCCACTGAAGGCTGTGTTTATTCTTTTCCTGTGCCCC
TCATAATGGAAGAAAGTAAACTGCTTATCCCGAGCCTTA

Protein Sequence

>7006 : length: 631
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIK
CVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKY
HPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNS
EEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTGKKSN
NLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHY
HIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSY
EKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKL
THPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYL
ERNSFIHRDLAARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYS
RFSSKSDVWSFGVLMWEVFTEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLR
CWQEKPEGRPSFEDLLRTIDELVECEETFGR