ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6929

Name

TCF3

Synonym

E2A|E47|ITF1|TCF-3|VDIR|bHLHb21;transcription factor 3;TCF3;transcription factor 3

Definition

VDR interacting repressor|class B basic helix-loop-helix protein 21|helix-loop-helix protein HE47|immunoglobulin transcription factor 1|kappa-E2-binding factor|negative vitamin D response element-binding protein|transcription factor 3 (E2A immunoglobulin

Position

19p13.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Notch-mediated HES/HEY network;PID Curated;200196

Pathway

p38 signaling mediated by MAPKAP kinases;PID Curated;200135

Pathway

Myogenesis;Reactome;REACT:21303

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Disease

Leukemia, acute lymphoblastic;OMIM

Disease

Acute lymphoblastic leukemia (ALL) (Precursor B lymphoblastic leukemia);KEGG DISEASE;H00001

Disease

Cancers;KEGG DISEASE

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

External Links

Links to cell senescence gene database

6929

Links to epithelial mesenchymal transition gene database

6929

Links to ovarian cancer gene database

6929

Links to endometrial cancer gene database

6929

Links to iHOP

6929

Sequence Information

Nucleotide Sequence

>6929 : length: 5550
CCGGGAAAAAGGCGTTCCAGCGCGCCCCCCGCCTTCGGCGCCGTGCAAAGTGGCTTCAAA
CATTCTCCAAGTCTCTCAAAGTCCTTGGGACGCCCCAGAAGTCTTCCAGCTCCCGTAGAA
TGCCCGTTTTAGCTCGCCACCCCCCCAACTAAGTCTGTCTTAAAATCGGTTTCAGCTACC
CCACAAAAAAGTGCGGTTTCGTAGTCCTCAAAAAAAGTCAGTTTCACACGCCCTCCAAAA
AAGAAAAAAACTGAGCGGGGGAGGGGCTGCGCTGGGGCGCCCGCTTCACACCCGGCCTCC
AGTTGGCAGACAAAGAGGGGATTTCTCTGCTTCTGAAGTTGGGTCTCCCTCGACCTCGGA
GGCTCCTCCCCACCCCCAGCCTCGGAGGTGTCTCCCGGGCTGCCCCCGTCCCCACCTGGG
GACCCCTGGGGAAAGTCGAGACTGGAGGGGCCTGGAGTGCATTTCTTTGGAATGGAAATT
TTTCTCTGTACCTTTTTCTGGGGGTGGAATGGGTCTTGGCAGGTGGATCCCCCATCCCCC
ATCTTAGAATGGAGCCCCCTGGGACCACGCGGGAGCACCCTGGTCTTGAGACGCTCTCCC
CGCTCATGGAGGGCAGGCAAGGGATGTTGTCAAAGTTTTGCTTAAAAATAATTCCCGGAT
ACATCGCGACAGTAAAGCAATCTAGGGCTGTTTTTTTTTTCTTTCCTGAATACTGTTGGG
GTTTTCTTGGGGGGAGGGAGATTGAGGGTGGAGGAAAGCTTTGCTGGTCCCTGCATAGGA
TGCGCGTCCCCCCCACCCCCGGCACTTTAAGTCTTGAAGCTTGTAAAAGAGTTTCGTGGT
TTTCTGACTTGTGGATTTCCTTCATGTTGAATTTGGGGGCGACCTGGTCTTCAACGGGCT
GTGCCATCTGCTGGGGGAGGGGGGAATCACCAAATTTCCCTCGGGGCGGGGTAGGATCGG
GCTGTTCCTCCCTTTCCCGGGGGTAGGGGGCCTCAGAGGAAGCCCGGGGTTGGTTGGAAA
TGAGAGAGTTGGAGAAAGGAGAGGTTCTGGCTGCCCTGCGTGCAGTTTAAACTTGGCAAC
TTGATGCCCTGGTGTTCCCTGGGGGAGTTAGGGAGTTTATATTTGCACACCCTCCCCCCA
TTTTTCAGACTCCCTGTGGTCTCTGGGGAGGACTCTGCAGGGACCTAGACTCTGGAATTC
CAGCTTCCCTGCGCCTGCTCCCAGGGCTCCCCGTGCCCCCAGGGCTCTGCTGGAACTCAG
ACCCCAGGGCGGTTGAGGGTTTTTTAGGTGGCTTTTAGCACTCTGTGCTTTGACCACTCA
CAACTCTTCTCCCCTCCCTGTTTCTCCCTGTCCATCTGTCCCCACATCCACCAAGCAGGG
TTTCCAGGCCTGAGGTGCCCGCCCTGGCCCCAGGAGAATGAACCAGCCGCAGAGGATGGC
GCCTGTGGGCACAGACAAGGAGCTCAGTGACCTCCTGGACTTCAGCATGATGTTCCCGCT
GCCTGTCACCAACGGGAAGGGCCGGCCCGCCTCCCTGGCCGGGGCGCAGTTCGGAGGTTC
AGGTCTTGAGGACCGGCCCAGCTCAGGCTCCTGGGGCAGCGGCGACCAGAGCAGCTCCTC
CTTTGACCCCAGCCGGACCTTCAGCGAGGGCACCCACTTCACTGAGTCGCACAGCAGCCT
CTCTTCATCCACATTCCTGGGACCGGGACTCGGAGGTGAGTGCCTGGCCTGGTGCGGTCC
CTCTGCTGTGCACAGATGTGCAGACGTGGGCCTTGGCATGGTCAGTGCACGCACAGCGCC
AGGCAAGAGCGGTGAGCGGGGCGCCTATGCCTCCTTCGGGAGAGACGCAGGCGTGGGCGG
CCTGACTCAGGCTGGCTTCCTGTCAGGCGAGCTGGCCCTCAACAGCCCCGGGCCCCTGTC
CCCTTCGGGCATGAAGGGGACCTCCCAGTACTACCCCTCCTACTCCGGCAGCTCCCGGCG
GAGAGCGGCAGACGGCAGCCTAGACACGCAGCCCAAGAAGGTCCGGAAGGTCCCGCCGGG
TCTTCCATCCTCGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGC
CTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGG
CAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCAT
GCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAG
TGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCA
TGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGC
CACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGG
CTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGAT
CTACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTC
CCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCCGGTGCCTTATC
GCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGA
GGCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCT
GCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTGGGCGGGCGGCA
CGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCAT
GCACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCC
CGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGCGAGATCAAGCG
GGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAA
GGAGCTGAAGGCCCCCCGGGCCCGGACCAGCCCAGACGAGGACGAGGACGACCTTCTCCC
CCCAGAGCAGAAGGCCGAGCGGGAGAAGGAGCGCCGGGTGGCCAATAACGCCCGGGAGCG
GCTGCGGGTCCGTGACATCAACGAGGCCTTTAAGGAGCTGGGGCGCATGTGCCAACTGCA
CCTCAACAGCGAGAAGCCCCAGACCAAACTGCTCATCCTGCACCAGGCTGTCTCGGTCAT
CCTGAACTTGGAGCAGCAAGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTGAA
ACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGC
TCCCCACCCAGGCCTGAGCGAAGCCCACAACCCCGCCGGGCACATGTGAAAGTAAACAAA
ACCTGAAAGCAAGCAACAAAACATACACTTTGTCAGAGAAGAAAAAAATGCCTTAACTAT
AAAAAGCGGAGAAATGGAAACATATCACTCAAGGGGGATGCTGTGGAAACCTGGCTTATT
CTTCTAAAGCCACCAGCAAATTGTGCCTAAGCGAAATATTTTTTTTAAGGAAAATAAAAA
CATTAGTTACAAGATTTTTTTTTTCTTAATGTAGATGAAAATTAGCAAGGATGCTGCCTT
TGGTCTCTGGTTTTTTTAAGCTTTTTTTGCATATGTTTTGTAAGCAACAAATTTTTTTGT
ATAAAAGTCCCGTGTCTCTCGCTATTTCTGCTGCTGTTCCTAGACTGAGCATTGCATTTC
TTGATCAACCAGATGATTAAACGTTGTATTAAAAAGACCCCGTGTAAACCTGAGCCCCCC
CGTCCCCCCCCCCCCCCGGAAGCCACTGCACACAGACAGAACGGGGACAGGCGGCGGGTC
TTTTGTTTTTTTGATGTTGGGGGTTCTCTTGGTTTTGTCATGTGGAAAGTGATGCGTGGG
CGTTCCCTGATGAAGGCACCTTGGGGCTTCCCTGCCGCATCCTCTCCCCTCAGGAAGGGG
ACTGACCTGGGCTTGGGGGAAGGGACGTCAGCAAGGTGGCTCTGACCCTCCCAGGTGACT
CTGCCAAGCAGCTGTGGCCCCCAGGGCTACCCTACACAACGCCCTCCCCAGGCCCCCCTA
AGCTGCTCTCCCTTGGAACCTGCACAGCTCTCTGAAATGGGGCATTTTGTTGGGACCAGT
GACCCCTGGCATGGGGACCACACCCTGGAGCCCGGTGCTGGGGACCTCCTGGACACCCTG
TCCTTCACTCCTTTGCCCCAGGGACCCAGGCTCATGCTCTGAACTCTGGCTGAGAGGATG
CTGCTCAGGAGCCAGCACAGGACACCCCCCACCCCACCCCACCATGTCCCCATTACACCA
GAGGGCCATCGTGACGTAGACAGGATGCCAGGGGCCTGGCCAGCCTCCCCCAATGCTGGG
GAGCATCCCTGGGCCTGGGGCCACACCTGCTGCCCTCCCTCTGTGTGGTCCAAGGGCAAG
AGTGGCTGGAGCCGGGGGACTGTGCTGGTCTGAGCCCCACGAAGGCCTTGGGCTGTGCGT
CCGACCCTGCTGCAGAACCAGCAGGGTGTCCCCTCGGGCCCATCTGTGTCCCATGTCCCA
GCACCCAGGCCTCTCTCCAGGTCTCCTTTTCTGGTCTTTTGCCATGAGGGTAACCAGCTC
TTCCCAGCTGGCTGGGGACTGTCTTGGGTTTAAAACTGCAAGTCTCCTACCCTGGGATCC
CATCCAGTTCCACACGAACTAGGGCAGTGGTCACTGTGGCACCCAGGTGTGGGCCTGGCT
AGCTGGGGGCCTTCATGTGCCCTTCATGCCCCTCCCTGCATTGAGGCCTTGTGGACCCCT
GGGCTGGCTGTGTTCATCCCCGCTGCAGGTCGGGCGTCTCCCCCCGTGCCACTCCTGAGA
CTCCCACCGTTACCCCCAGGAGATCCTGGACTGCCTGACTCCCCTCCCCAGACTGGCTTG
GGAGCCTGGGCCCCATGGTAGATGCAAGGGAAACCTCAAGGCCAGCTCAATGCCTGGTAT
CTGCCCCCAGTCCAGGCCAGGCGGAGGGGAGGGGCTGTCCGGCTGCCTCTCCCTTCTCGG
TGGCTTCCCCTACGCCCTGGGAGTTTGATCTCTTAAGGGAACTTGCCTCTCCCTCTTGTT
TTGCTCCTGGCCCTGCCCCTAGGTCTGGGTGGGCAGTGGCCCCATAGCCTCTGGAACTGT
GCGTTCTGCATAGAATTCAAACGAGATTCACCCAGCGCGAGGAGGAAGAAACAGCAGTTC
CTGGGAACCACAATTATGGGGGGTGGGGGGTGTGATCTGAGTGCCTCAAGATGGTTTTCA
AAAAAATTTTTTTAAAGAAAATAATTGTATACGTGTCAACACAGCTGGCTGGATGATTGG
GACTTTAAAACGACCCTCTTTCAGGTGGATTCAGAGACCTGTCCTGTATATAACAGCACT
GTAGCAATAAACGTGACATTTTATAACGAT

Protein Sequence

>6929 : length: 683
MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWG
SGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGGECLAWCGPSAVHRCADVGLG
MVSARTAPGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYP
SYSGSSRRRAADGSLDTQPKKVRKVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTYP
APFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQH
ERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLGSRGTTAGSSGDA
LGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQS
KIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDG
LAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAA
DHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKE
LGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVG
DPQMVLSAPHPGLSEAHNPAGHM