ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6926

Name

TBX3

Synonym

TBX3-ISO|UMS|XHL;T-box 3;TBX3;T-box 3

Definition

T-box protein 3|T-box transcription factor TBX3|bladder cancer related protein XHL

Position

12q24.21

Gene Type

protein-coding

External Links

Links to cell senescence gene database

6926

Links to epithelial mesenchymal transition gene database

6926

Links to ovarian cancer gene database

6926

Links to endometrial cancer gene database

6926

Links to iHOP

6926

Sequence Information

Nucleotide Sequence

>6926 : length: 4814
GAATTCTAGAGGCGGCGGAGGGTGGCGAGGAGCTCTCGCTTTCTCTCGCTCCCTCCCTCT
CCGACTCCGTCTCTCTCTCTCTCTCTCTCTCTCCCCTCCCTCTCTTTCCCTCTGTTCCAT
TTTTTCCCCCTCTAAATCCTCCCTGCCCTGCGCGCCTGGACACAGATTTAGGAAGCGAAT
TCGCTCACGTTTTAGGACAAGGAAGAGAGAGAGGCACGGGAGAAGAGCCCAGCAAGATTT
GGATTGAAACCGAGACACCCTCCGGAGGCTCGGAGCAGAGGAAGGAGGAGGAGGGCGGCG
AACGGAAGCCAGTTTGCAATTCAAGTTTTGATAGCGCTGGTAGAAGGGGGTTTAAATCAG
ATTTTTTTTTTTTTAAAGGAGAGAGACTTTTTCCGCTCTCTCGCTCCCTGTTAAAGCCGG
GTCTAGCACAGCTGCAGACGCCACCAGCGAGAAAGAGGGAGAGGAAGACAGATAGGGGGC
GGGGGAAGAAGAAAAAGAAAGGTAAAAAGTCTTCTAGGAGAACCTTTCACATTTGCAACA
AAAGACCTAGGGGCTGGAGAGAGATTCCTGGGACGCAGGGCTGGAGTGTCTATTTCGAGC
TCAGCGGCAGGGCTCGGGCGCGAGTCGAGACCCTGCTCGCTCCTCTCGCTTCTGAAACCG
ACGTTCAGGAGCGGCTTTTTAAAAACGCAAGGCACAAGGACGGTCACCCGCGCGACTATG
TTTGCTGATTTTTCGCCTTGCCCTCTTTAAAAGCGGCCTCCCATTCTCCAAAAGACACTT
CCCCTCCTCCCTTTGAAGTGCATTAGTTGTGATTTCTGCCTCCTTTTCTTTTTTCTTTCT
TTTTTGTTTTGCTTTTTCCCCCCTTTTGAATTATGTGCTGCTGTTAAACAACAACAAAAA
AACAACAAAACACAGCAGCTGCGGACTTGTCCCCGGCTGGAGCCCAGCGCCCCGCCTGGA
GTGGATGAGCCTCTCCATGAGAGATCCGGTCATTCCTGGGACAAGCATGGCCTACCATCC
GTTCCTACCTCACCGGGCGCCGGACTTCGCCATGAGCGCGGTGCTGGGTCACCAGCCGCC
GTTCTTCCCCGCGCTGACGCTGCCTCCCAACGGCGCGGCGGCGCTCTCGCTGCCGGGCGC
CCTGGCCAAGCCGATCATGGATCAATTGGTGGGGGCGGCCGAGACCGGCATCCCGTTCTC
CTCCCTGGGGCCCCAGGCGCATCTGAGGCCTTTGAAGACCATGGAGCCCGAAGAAGAGGT
GGAGGACGACCCCAAGGTGCACCTGGAGGCTAAAGAACTTTGGGATCAGTTTCACAAGCG
GGGCACCGAGATGGTCATTACCAAGTCGGGAAGGCGAATGTTTCCTCCATTTAAAGTGAG
ATGTTCTGGGCTGGATAAAAAAGCCAAATACATTTTATTGATGGACATTATAGCTGCTGA
TGACTGTCGTTATAAATTTCACAATTCTCGGTGGATGGTGGCTGGTAAGGCCGACCCCGA
AATGCCAAAGAGGATGTACATTCACCCGGACAGCCCCGCTACTGGGGAACAGTGGATGTC
CAAAGTCGTCACTTTCCACAAACTGAAACTCACCAACAACATTTCAGACAAACATGGATT
TACTTTGGCCTTCCCAAGTGATCACGCTACGTGGCAGGGGAATTATAGTTTTGGTACTCA
GACTATATTGAACTCCATGCACAAATACCAGCCCCGGTTCCACATTGTAAGAGCCAATGA
CATCTTGAAACTCCCTTATAGTACATTTCGGACATACTTGTTCCCCGAAACTGAATTCAT
CGCTGTGACTGCATACCAGAATGATAAGATAACCCAGTTAAAAATAGACAACAACCCTTT
TGCAAAAGGTTTCCGGGACACTGGAAATGGCCGAAGAGAAAAAAGAAAACAGCTCACCCT
GCAGTCCATGAGGGTGTTTGATGAAAGACACAAAAAGGAGAATGGGACCTCTGATGAGTC
CTCCAGTGAACAAGCAGCTTTCAACTGCTTCGCCCAGGCTTCTTCTCCAGCCGCCTCCAC
TGTAGGGACATCGAACCTCAAAGATTTATGTCCCAGCGAGGGTGAGAGCGACGCCGAGGC
CGAGAGCAAAGAGGAGCATGGCCCCGAGGCCTGCGACGCGGCCAAGATCTCCACCACCAC
GTCGGAGGAGCCCTGCCGTGACAAGGGCAGCCCCGCGGTCAAGGCTCACCTTTTCGCTGC
TGAGCGGCCCCGGGACAGCGGGCGGCTGGACAAAGCGTCGCCCGACTCACGCCATAGCCC
CGCCACCATCTCGTCCAGCACTCGCGGCCTGGGCGCGGAGGAGCGCAGGAGCCCGGTTCG
CGAGGGCACAGCGCCGGCCAAGGTGGAAGAGGCGCGCGCGCTCCCGGGCAAGGAGGCCTT
CGCGCCGCTCACGGTGCAGACGGACGCGGCCGCCGCGCACCTGGCCCAGGGCCCCCTGCC
TGGCCTCGGCTTCGCCCCGGGCCTGGCGGGCCAACAGTTCTTCAACGGGCACCCGCTCTT
CCTGCACCCCAGCCAGTTTGCCATGGGGGGCGCCTTCTCCAGCATGGCGGCCGCTGGCAT
GGGTCCCCTCCTGGCCACGGTTTCTGGGGCCTCCACCGGTGTCTCGGGCCTGGATTCCAC
GGCCATGGCCTCTGCCGCTGCGGCGCAGGGACTGTCCGGGGCGTCCGCGGCCACCCTGCC
CTTCCACCTCCAGCAGCACGTCCTGGCCTCTCAGGGCCTGGCCATGTCCCCTTTCGGAAG
CCTGTTCCCTTACCCCTACACGTACATGGCCGCAGCGGCGGCCGCCTCCTCTGCGGCAGC
CTCCAGCTCGGTGCACCGCCACCCCTTCCTCAATCTGAACACCATGCGCCCGCGGCTGCG
CTACAGCCCCTACTCCATCCCGGTGCCGGTCCCGGACGGCAGCAGTCTGCTCACCACCGC
CCTGCCCTCCATGGCGGCGGCCGCGGGGCCCCTGGACGGCAAAGTCGCCGCCCTGGCCGC
CAGCCCGGCCTCGGTGGCAGTGGACTCGGGCTCTGAACTCAACAGCCGCTCCTCCACGCT
CTCCTCCAGCTCCATGTCCTTGTCGCCCAAACTCTGCGCGGAGAAAGAGGCGGCCACCAG
CGAACTGCAGAGCATCCAGCGGTTGGTTAGCGGCTTGGAAGCCAAGCCGGACAGGTCCCG
CAGCGCGTCCCCGTAGACCCGTCCCAGACACGTCTTTTCATTCCAGTCCAGTTCAGGCTG
CCGTGCACTTTGTCGGATATAAAATAAACCACGGGCCCGCCATGGCGTTAGCCCTTCCTT
TTGCAGTTGCGTCTGGGAAGGGGCCCCGGACTCCCTCGAGAGAATGTGCTAGAGACAGCC
CCTGTCTTCTTGGCGTGGTTTATATGTCCGGGATCTGGATCAGATTCTGGGGGCTCAGAA
ACGTCGGTTGCATTGAGCTACTGGGGGTAGGAGTTCCAACATTTATGTCCAGAGCAACTT
CCAGCAAGGCTGGTCTGGGTCTCTGCCCACCAGGCGGGGAGGTGTTCAAAGACATCTCCC
TCAGTGCGGATTTATATATATATTTTTCCTTCACTGTGTCAAGTGGAAACAAAAACAAAA
TCTTTCAAAAAAAAAATCGGGACAAGTGAACACATTAACATGATTCTGTTTGTGCAGATT
AAAAACTTTATAGGGACTTGCATTATCGGTTCTCAATAAATTACTGAGCAGCTTTGTTTG
GGGAGGGAAGTCCCTACCATCCTTGTTTAGTCTATATTAAGAAAATCTGTGTCTTTTTAA
TATTCTTGTGATGTTTTCAGAGCCGCTGTAGGTCTCTTCTTGCATGTCCACAGTAATGTA
TTTGTGGTTTTTATTTTGAACGCTTGCTTTTAGAGAGAAAACAATATAGCCCCCTACCCT
TTTCCCAATCCTTTGCCCTCAAATCAGTGACCCAAGGGAGGGGGGGATTTAAAGGGAAGG
AGTGGGCAAAACACATAAAATGAATTTATTATATCTAAGCTCTGTAGCAGGATTCATGTC
GTTCTTTGACAGTTCTTTCTCTTTCCTGTATATGCAATAACAAGGTTTTAAAAAAATAAT
AAAGAAGTGAGACTATTAGACAAAGTATTTATGTAATTATTTGATAACTCTTGTAAATAG
GTGGAATATGAATGCTTGGAAAATTAAACTTTAATTTATTGACATTGTACATAGCTCTGT
GTAAATAGAATTGCAACTGTCAGGTTTTGTGTTCTTGTTTTCCTTTAGTTGGGTTTATTT
CCAGGTCACAGAATTGCTGTTAACACTAGAAAACACACTTCCTGCACCAACACCAATACC
CTTTCAAAAGAGTTGTCTGCAACATTTTTGTTTTCTTTTTTAATGTCCAAAAGTGGGGGA
AAGTGCTATTTCCTATTTTCACCAAAATTGGGGAAGGAGTGCCACTTTCCAGCTCCACTT
CAAATTCCTTAAAATATAACTGAGATTGCTGTGGGGAGGGAGGAGGGCAGAGGCTGCGGT
TTGACTTTTTAATTTTTCTTTTGTTATTTGTATTTGCTAGTCTCTGATTTCCTCAAAACG
AAGTGGAATTTACTACTGTTGTCAGTATCGGTGTTTTGAATTGGTGCCTGCCTATAGAGA
TATATTCACAGTTCAAAAGTCAGGTGCTGAGAGATGGTTTAAAGACAAATTCATGAAGGT
ATATTTTGTGTTATAGTTGTTGATGAGTTCTTTGGTTTTCTGTATTTTTCCCCCTCTCTT
TAAAACATCACTGAAATTTCAATAAATTTTTATTGAAATGTCTAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAA

Protein Sequence

>6926 : length: 743
MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNGAAALSLPGAL
AKPIMDQLVGAAETGIPFSSLGPQAHLRPLKTMEPEEEVEDDPKVHLEAKELWDQFHKRG
TEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEM
PKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTLAFPSDHATWQGNYSFGTQT
ILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFA
KGFRDTGNGRREKRKQLTLQSMRVFDERHKKENGTSDESSSEQAAFNCFAQASSPAASTV
GTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAE
RPRDSGRLDKASPDSRHSPATISSSTRGLGAEERRSPVREGTAPAKVEEARALPGKEAFA
PLTVQTDAAAAHLAQGPLPGLGFAPGLAGQQFFNGHPLFLHPSQFAMGGAFSSMAAAGMG
PLLATVSGASTGVSGLDSTAMASAAAAQGLSGASAATLPFHLQQHVLASQGLAMSPFGSL
FPYPYTYMAAAAAASSAAASSSVHRHPFLNLNTMRPRLRYSPYSIPVPVPDGSSLLTTAL
PSMAAAAGPLDGKVAALAASPASVAVDSGSELNSRSSTLSSSSMSLSPKLCAEKEAATSE
LQSIQRLVSGLEAKPDRSRSASP