ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6909

Name

TBX2

Synonym

T-box 2;TBX2;T-box 2

Definition

T-box protein 2|T-box transcription factor TBX2

Position

17q23.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

tumor suppressor arf inhibits ribosomal biogenesis;PID BioCarta;100237

Disease

DEVELOPMENTAL;GAD

Disease

Serum creatinine;NHGRI

Disease

height;GAD

External Links

Links to cell senescence gene database

6909

Links to epithelial mesenchymal transition gene database

6909

Links to ovarian cancer gene database

6909

Links to endometrial cancer gene database

6909

Links to iHOP

6909

Sequence Information

Nucleotide Sequence

>6909 : length: 5543
TTCATGATCTGGAAAGAGGCCGGTGGGAGCCAGCGTGGCAACTGAAGGAGCAAGAGTACT
GTCTGAGATGAGAAAAGGCACGGTGGGCCTGAGGCCAATTCAAGCACACAAGCTCAAACA
CCAGGGCCAGCCCCTCTGTCAAGGAGCAGAGGCCAGGCTAGGCAGCCACCAGTCTGGAAG
TGTATATGGTTTCTCAGTGGTAATTTTTTATTTTCACAATTCAGGGACTCATGAAACTAG
AAAGTACCTGAGAGTTCTGTTCGAGCCTCATTTTTTTTGCAGATGACAAGCAAGCCTGAG
CCCCAGAGAAGGGCAGGGCCTTGCCCAAGGTCACAAAGTCACACGCCTAGTGAGCCTATC
CCTGTCTGCACCTGGCTGCTTCACACCCTGGCCAGTTCCCTTAGAGGGACCCAAATCCGA
ACTGACCTCCCTGTCCTGTGCCCCTATCCCATCCAGAATGCTGACCCCACTGATCCCCAT
CCTGACTCCATCAGGCTTCCTGCCTGGGCTGAGAGACTGAATTTGCAGCTGCTCCCTTGC
CCCTGTGTAGCTGGAAGGCAGCCCTCCCACTGCAGACCTAGAACTGGAGGCTCTAGAGGC
AAAGGGACAGTGCATCCTGTATGTCTCGAATTCAGAGCAAGAGCCCAGGGGAGGGTGGCA
GCCCTGGCATCTCAGGATCACCTTGCTGTAGGAGCAGGGGTAGGCAGCTCAGCAGCACCG
GCTTCTTAGGAGTGGGTTTGGACTTGCTCTCTTTAAGGTCCCAGGGTCCCATCCCAGCTC
TGCCACCAGCAGAAAACGACCTTCAGGAATCAGCCTGAGTGTTCGCGCCCGAGCCCGATT
GGAAGCAGGTGCGTGGTCGCTTCACTCTCCCCGTGCACACCTTGAGTTATAGCTCTCGCT
GCGCACAGAGGGCACCACACGGGGCCCGACACACACACACACACACACACACACACACAC
ACACACACACACACCATCACTTCATGGGGGGGAAACTGAGGCTGCCGGAAGACAGAAAAC
GAAGACTGATCACAGAAGAGGGGGCTTCAATCACAGGTGCTCGCAGACACCCCAACTCCC
TCACGCGTTACTCAGCACTCCTTAACTTAGGAGACGTGCGCTTCCGAGAGATGAGAAGAA
ACTAAAAAAGTGGTTGGCAGGGCGAAGAGAGGAAGCCGGTATTTCGGAAGAAGGAGACTT
TCGTCTCCGGTACCGGATAGGGCGAAAATTCGTTGGGTCGCGGGTGGAGAATCCGGGGTC
CGCCCGCGCGGTGCCGCCCTGTGCTCAGCGAAAGGTGCGCTCACCTTCCTGGCCCCGAGG
ATCCGCTCCTCCCGGCCGCTGGAAAGCTCAGGGCGGGGCCCGGGCCTGCGGAGAACTCCA
GGTTCCTTCCGAGTCTTCCGGTGAAGGCGGGCGCGGGTAGGGGGTCCCCGCGTTTCCCCA
GCGCAAGGCCGCGTCCCGCTCCCGCCCGCGCCGGCCCCAGCAGGGCTCGGCCATGGCTCC
ACTCACCAGCTCCCGCCACCTGGGATCCGCTCCCGGACCTCGGCCGCCCGAGCCTCCCGA
CTCGCCCGCCCACCGGCCTCGCTTTCCAGTGCCTGCTGTCTCTTTCCGGGGCGCAGGGAC
CCCCAGGCGGCGCCACGACCCGGAGCTGGGTCGGAGGCCAGGCTGGGGCTCGGGCCAGAG
CGGCCGGGCCTCTGGGCGCGGGAGAAGGAGGGCGCCCCCTCTCCGCTCGGGGTCGTGTCA
ATGCTTTGCACTTGGGGCCGGCGTGCGGCTGCGGGTCCTTCCCCAAGGCCCCGGGACCCG
GGCTCCCCTCGCCTCAGGCCCTTTCGGCGGGTCAGGTCGGCCCTCCGCGCTCTCCAGTCC
GGCGCAGGCAGCCGCAGGCGCGGGCGGGCGGTGGGGGCCGGGGCAGGAGGAGGGGTCTCG
GGGCCCGGCGGCCCGTCATTGGTTAATATTTTATTCTGTTGACATGTTTTCTTACTGCTG
AGGCTTCCGACACCTTCTCCCAGGCCCCCCCTCCCGGCCGGAGCTTGGCCTGAGCTGTCA
AAACCCCGCCCCCGGAGACCCACAATTGGTCCAAAAAGCGTAAAATCAGCAATCAAGGGG
GGCCTGGCTCGTTAGCGCAGGGGATCCGAGCTGGGCAGGACATGTGAGATAGTCACAGTT
TTCCAGAGATCACGACAAGATCTAACCAGTCGCGCGTGGTCCCCGGCGCCGGAGCGGGCC
AGCTCAGCCCGGCCCAGCCCGGCCCCGCGCAGAGCCCCCGCCGCCCCCGCGCACAGAGCC
GGGTGCCCCTTGCGGTGCGCCGGACGGGAAGCCCCGAGGAGCAGCTGCTGCGCCCGCCAC
CCGGGTCGTCCGTCCACCGCGCGCGCCGCCGCCCGGGCCGGGGGTCCGAGCCGCGCGCCC
CCGGCCCCGGCCCCGGCCCCCGGGCGCCTGGGCCGGATGTCCCGATGAGAGAGCCGGCGC
TGGCGGCCAGCGCCATGGCTTACCACCCGTTCCACGCGCCACGGCCCGCCGACTTCCCCA
TGTCCGCCTTTCTGGCGGCGGCGCAGCCCTCCTTCTTCCCGGCACTCGCGCTGCCGCCCG
GCGCGCTGGCCAAGCCGCTGCCCGACCCGGGCCTGGCGGGGGCGGCGGCCGCGGCGGCGG
CGGCGGCAGCAGCGGCCGAGGCGGGGCTGCACGTCTCGGCACTGGGCCCGCACCCGCCCG
CCGCGCATCTGCGCTCCCTCAAGAGCCTGGAGCCCGAGGACGAGGTGGAGGACGACCCCA
AGGTGACGCTGGAGGCCAAGGAGCTGTGGGACCAGTTCCACAAGCTAGGCACGGAGATGG
TCATCACCAAGTCCGGGAGGCGGATGTTCCCCCCCTTCAAGGTGCGAGTCAGCGGCCTGG
ACAAGAAGGCCAAGTATATCCTGCTGATGGACATTGTAGCCGCTGACGATTGCCGCTATA
AGTTCCACAACTCGCGCTGGATGGTGGCGGGCAAGGCCGACCCTGAGATGCCCAAACGCA
TGTACATCCACCCAGACAGCCCAGCCACGGGGGAGCAGTGGATGGCTAAGCCTGTGGCCT
TCCACAAGCTGAAGCTGACCAACAACATCTCTGACAAGCACGGCTTCACCATCCTAAACT
CCATGCACAAGTACCAGCCGCGCTTCCACATAGTGCGAGCCAACGACATCCTGAAGCTGC
CTTACAGCACCTTCCGCACCTACGTGTTCCCGGAGACCGACTTCATCGCCGTCACTGCCT
ACCAGAATGACAAGATCACACAGCTGAAGATCGACAACAACCCGTTTGCCAAGGGCTTCC
GGGACACCGGGAACGGCCGGCGGGAGAAAAGGAAGCAGCTGACGCTGCCGTCTCTACGCT
TGTACGAGGAGCACTGCAAACCCGAGCGCGATGGCGCGGAGTCAGACGCCTCGTCGTGCG
ACCCTCCCCCCGCGCGGGAACCACCCACCTCCCCGGGCGCAGCGCCCAGTCCGCTGCGCC
TGCACCGGGCCCGAGCTGAGGAGAAGTCGTGCGCCGCGGACAGCGACCCGGAGCCTGAGC
GGTTGAGCGAGGAGCGTGCGGGGGCGCCGCTAGGCCGCAGCCCGGCTCCAGACAGCGCCA
GCCCCACTCGCTTGACCGAACCCGAGCGCGCCCGGGAGCGGCGTAGTCCCGAGAGGGGCA
AGGAGCCGGCCGAGAGCGGCGGGGACGGCCCGTTCGGCCTGAGGAGCCTGGAGAAGGAGC
GCGCCGAAGCTCGGAGGAAGGACGAGGGGCGCAAGGAGGCGGCCGAGGGCAAGGAGCAGG
GCCTGGCGCCGCTGGTGGTGCAGACAGACAGTGCGTCCCCCCTGGGCGCCGGACACCTGC
CCGGCCTGGCCTTTTCCAGCCACTTGCACGGGCAGCAGTTCTTTGGGCCGCTGGGAGCCG
GCCAGCCGCTCTTCCTGCACCCTGGACAGTTCACCATGGGCCCTGGCGCCTTCTCCGCCA
TGGGCATGGGTCACCTACTGGCCTCGGTGGCAGGCGGCGGCAACGGCGGAGGTGGCGGGC
CTGGGACCGCCGCGGGGCTGGACGCAGGCGGGCTGGGTCCCGCGGCCAGCGCAGCAAGCA
CCGCCGCGCCCTTCCCGTTCCACCTCTCCCAGCACATGCTGGCATCTCAGGGAATTCCAA
TGCCCACTTTCGGAGGCCTCTTCCCCTACCCCTACACCTACATGGCAGCAGCAGCCGCAG
CCGCCTCGGCTTTGCCCGCCACTAGTGCTGCAGCTGCCGCCGCCGCAGCCGCCGGCTCCC
TCTCCCGGAGCCCCTTCCTGGGCAGTGCCCGGCCCCGACTGCGTTTCAGCCCCTATCAGA
TCCCGGTCACCATCCCGCCTAGCACTAGCCTCCTCACCACCGGGCTGGCCTCTGAGGGCT
CCAAGGCCGCTGGTGGAAACAGCCGGGAGCCTAGCCCCCTGCCCGAGCTGGCTCTCCGCA
AAGTAGGGGCCCCATCCCGCGGTGCCCTGTCGCCCAGTGGCTCGGCCAAGGAGGCGGCCA
ATGAACTGCAGAGCATCCAGAGACTGGTGAGTGGGCTGGAGAGCCAGCGAGCCCTCTCCC
CAGGCCGGGAGTCGCCCAAGTGAGGGGCTGCCCAGCTGCTCCCCTGCCACGCAGGCCACC
CGGGCTGCCTGCCCCTGCTGCTTGGGACGTGTACAGCACAGAATGAGTATTTATTTAAAT
AAAGGAGAAAAGTGGGCTGCAGCAGCCGGAATAGAGCCTCGTCTGGCAAGTCGGGGCCTG
GGACACTTCCCTGGGCCTCAACAAGGATCAGGCTGCTGGAAACACAGTCACTTGGGAGCT
GCTGGGCTAGGTCCAGATCCGCTCCAGCGTCAAGGTGGCATCCGAAGGTGTCTCTGGTCT
TCCAGCGAGGTGGGAGAGGCCTCATCCAGGGCCCAGCGGTCCCTGCAGAAGCCAGAAGGT
GCAGGGGCCAGGGGTGGGAGCATCGGAGGGAGTCCCAGAGCCCTGGACCTTGGGCCTAGA
CCGCGTGATAAAACTGGGTTGAGGGATGCTGGAACCAGTTACGACTGAAGTCAGTGTAGA
CCTGAGCTGGGAGGGAACCTGTTAGTCTCCCCACCTCTTCCCTGAAGAGACAGGCACCCC
TCCCAGCCGTGGTCAACGGAGGGAGTGGCACTTCTGCCTTGAGTCCCCAGGGGAAAAAAA
AAAAAGATATTTATGAAATAAATGGTAATTTGTGTAAATAAGCTTTAAGGTTCCCAGAAT
ATGCAAATTGGTATTAATTTATTCAAAGGTGTACATTGCTGTGTACATATATTTAGAGAT
TAACTCATACATTTAAAGTTTTTTTCATTTTACGTGAGCATCTATATTGTACAGGGCTGG
GGGGGCCCTTGGCTGCGGGAGAAGGCCCAGAGCCCTGGAGGAGCCACCACCCCGCCGGCC
CCTCGACCCCTCGGCCCCTCGGCCCCTCCGCCCGGGTTTGGCTCGCCCGGCCCGCGGGCT
CCACCTCAGGTTTTCACTTTTCGCTCCGGAGCGAGAACGAAACGACAAAAACGCAAGAAA
ACAATAAAACGCTAGAAAGCGAA

Protein Sequence

>6909 : length: 712
MREPALAASAMAYHPFHAPRPADFPMSAFLAAAQPSFFPALALPPGALAKPLPDPGLAGA
AAAAAAAAAAAEAGLHVSALGPHPPAAHLRSLKSLEPEDEVEDDPKVTLEAKELWDQFHK
LGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADP
EMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRAN
DILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQLT
LPSLRLYEEHCKPERDGAESDASSCDPPPAREPPTSPGAAPSPLRLHRARAEEKSCAADS
DPEPERLSEERAGAPLGRSPAPDSASPTRLTEPERARERRSPERGKEPAESGGDGPFGLR
SLEKERAEARRKDEGRKEAAEGKEQGLAPLVVQTDSASPLGAGHLPGLAFSSHLHGQQFF
GPLGAGQPLFLHPGQFTMGPGAFSAMGMGHLLASVAGGGNGGGGGPGTAAGLDAGGLGPA
ASAASTAAPFPFHLSQHMLASQGIPMPTFGGLFPYPYTYMAAAAAAASALPATSAAAAAA
AAAGSLSRSPFLGSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLP
ELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLESQRALSPGRESPK