ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6901

Name

TAZ

Synonym

BTHS|CMD3A|EFE|EFE2|G4.5|LVNCX|Taz1;tafazzin;TAZ;tafazzin

Definition

protein G4.5

Position

Xq28

Gene Type

protein-coding

Pathways and Diseases

Pathway

Glycerophospholipid metabolism;KEGG PATHWAY;hsa00564

Disease

Circulatory system diseases;KEGG DISEASE

Disease

Cardiac diseases;KEGG DISEASE

Disease

Cardiomyopathy, dilated, 3A;OMIM

Disease

Barth syndrome;OMIM

Disease

Dilated cardiomyopathy (DCM);KEGG DISEASE;H00294

Disease

Left ventricular noncompaction, X-linked;OMIM

Disease

Endocardial fibroelastosis-2;OMIM

External Links

Links to cell senescence gene database

6901

Links to epithelial mesenchymal transition gene database

6901

Links to ovarian cancer gene database

6901

Links to endometrial cancer gene database

6901

Links to iHOP

6901

Sequence Information

Nucleotide Sequence

>6901 : length: 2230
AGTGTGCTGGGCAGGGGGAGGAAAGGCGAGGATTCGGGACGGGCCCAGCCTCGTCAGAAC
AAACCCCTTCTCGCTGCCTTTTCATGGAGCCCTGGCACTCCGGTTTCCGGGCGTTCTGCC
CCAGGGCTGAGACTTGGATTTGTGGCTCCTGCAGCATCCCTGAGGGAGCATGATTTGGAG
AGGGCCTTGGGCATGGAGCAGGACCAAGGAACGGCCACAGGGCATATCTTACAGCTCCTT
TAACGTCAGGCCTCCAGAACCCTCTGTTCTCTAAACCATCCAGGGCCCCACAGTCTTGGG
AAAAATTTGGGGGTTGGACATAGGATATCCTGTGAGGAAGTTCTGGGCCAGGGACTGGAA
GCCCAGTGTCCTGGCTTCAGGTTTGCCCCTGGCTGGGCGTGTACCGTTCAGCCCTATTTG
GGAGCCTGGTTGCCACACCTAGAGGTTCCTGCTCTGCTGACTTCACAGGAAGTTGCTTGG
CTCTGGTAACCAGATGGCCGGGTGGAGGGGTGCCTGGGGCTTCCACTCCTGAACAGAGAG
CTTAACTGTCCTAGAGTTCATGGGGAGCCACCTAGCCACACTGGAGCCCTTCAGAGCTCA
CCCTGGCTGCTGGGTGGAGAAAGGCCTATAGATGTCACAGGTGGATCCTGGGAGGCCAGG
AAGGAGGACTTGGAGCCATCCACTAGCCTAGACTGGGCTGGTTGCAGTGACAGTACAGGG
AGAAGTATAGAAGAATGGGCATTGTCCAAGGATCCTGAAACTCCGCCACATCTGGAACCT
GAAGTTGATGCGTTGGTGAGGAGGAATGGGCCCCTCGAAGTGGGCCGGGCCGGCCCCACC
TGCCTCTGCCCAGATTTGCCCTCCTCCTGCTCTGCCCAGGAGGTGGCGTCCAGCAGTCCA
GGCAGGGCATGGGGACCCCTGCAGCTGCAGACATCTGCTTCACCAAGGAGCTACACTCCC
ACTTCTTCAGCTTGGGCAAGTGTGTGCCTGTGTGCCGAGGAGCAGAATTTTTCCAAGCAG
AGAATGAGGGGAAAGGTGTTCTAGACACAGGCAGGCACATGCCAGGTGCTGGAAAAAGAA
GAGAGAAAGGAGATGGCGTCTACCAGAAGGGGATGGACTTCATTTTGGAGAAGCTCAACC
ATGGGGACTGGGTGCATATCTTCCCAGAAGGGAAAGTGAACATGAGTTCCGAATTCCTGC
GTTTCAAGTGGGGAATCGGGCGCCTGATTGCTGAGTGTCATCTCAACCCCATCATCCTGC
CCCTGTGGCATGTCGGAATGAATGACGTCCTTCCTAACAGTCCGCCCTACTTCCCCCGCT
TTGGACAGAAAATCACTGTGCTGATCGGGAAGCCCTTCAGTGCCCTGCCTGTACTCGAGC
GGCTCCGGGCGGAGAACAAGTCGGCTGTGGAGATGCGGAAAGCCCTGACGGACTTCATTC
AAGAGGAATTCCAGCATCTGAAGACTCAGGCAGAGCAGCTCCACAACCACCTCCAGCCTG
GGAGATAGGCCTTGCTTGCTGCCTTCTGGATTCTTGGCCCGCACAGAGCTGGGGCTGAGG
GATGGACTGATGCTTTTAGCTCAAACGTGGCTTTTAGACAGATTTGTTCATAGACCCTCT
CAAGTGCCCTCTCCGAGCTGGTAGGCATTCCAGCTCCTCCGTGCTTCCTCAGTTACACAA
AGGACCTCAGCTGCTTCTCCCACTTGGCCAAGCAGGGAGGAAGAAGCTTAGGCAGGGCTC
TCTTTCCTTCTTGCCTTCAGATGTTCTCTCCCAGGGGCTGGCTTCAGGAGGGAGCATAGA
AGGCAGGTGAGCAACCAGTTGGCTAGGGGAGCAGGGGGCCCACCAGAGCTGTGGAGAGGG
GACCCTAAGACTCCTCGGCCTGGCTCCTACCCACCGCCCTTGCCGAACCAGGAGCTGCTC
ACTACCTCCTCAGGGATGGCCGTTGGCCACGTCTTCCTTCTGCCTGAGCTTCCCCCCCAC
CACAGGCCCTTTCCTCAGGCAAGGTCTGGCCTCAGGTGGGCCGCAGGCGGGAAAAGCAGC
CCTTGGCCAGAAGTCAAGCCCAGCCACGTGGAGCCTAGAGTGAGGGCCTGAGGTCTGGCT
GCTTGCCCCCATGCTGGCGCCAACAACTTCTCCATCCTTTCTGCCTCTCAACATCACTTG
AATCCTAGGGCCTGGGTTTTCATGTTTTTGAAACAGAACCATAAAGCATATGTGTTGGCT
TGTTGTAAAA

Protein Sequence

>6901 : length: 310
MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWAQAEAGPPGYPCPAGEYMNHL
TVHNREVLYELIEKRGPATPLITVSNHQSCMDDPHLWGILKLRHIWNLKLMRWTPAAADI
CFTKELHSHFFSLGKCVPVCRGAEFFQAENEGKGVLDTGRHMPGAGKRREKGDGVYQKGM
DFILEKLNHGDWVHIFPEGKVNMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLP
NSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAE
QLHNHLQPGR