ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6900

Name

CNTN2

Synonym

AXT|FAME5|TAG-1|TAX|TAX1;contactin 2 (axonal);CNTN2;contactin 2 (axonal)

Definition

axonal glycoprotein TAG-1|axonin-1 cell adhesion molecule|contactin 2 (transiently expressed)|contactin-2|transient axonal glycoprotein 1|transiently-expressed axonal glycoprotein

Position

1q32.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

NrCAM interactions;PID Reactome;500103

Pathway

Cell adhesion molecules (CAMs);KEGG PATHWAY;hsa04514

Pathway

NCAM1 interactions;PID Reactome;500087

Pathway

L1CAM interactions;PID Reactome;500097

Pathway

chaperones modulate interferon signaling pathway;PID BioCarta;100016

External Links

Links to cell senescence gene database

6900

Links to epithelial mesenchymal transition gene database

6900

Links to ovarian cancer gene database

6900

Links to endometrial cancer gene database

6900

Links to iHOP

6900

Sequence Information

Nucleotide Sequence

>6900 : length: 7860
GGGCGCGCTCACACACACGCGCCCTCACCCGCCACCGCCGCCGCGGCCGCCGCCGCACCC
GGACAGCGAGCGGCTGAGGCCGCCAGGGCCCAAAGGACAGCGGCCCAGACAGGGGCTGGC
GGCCCGGCCGGCCCCGGCTCACCGACTCGGGCAGCATCCACCTGCCCCAGCCAACACCCT
TCTCTCGCCCCAGGTCCTTTCTCAGCCTCCAGCTGGGCTGTCCCCAAGCTGAGCTGAGGC
TCTTCTCCTCCGATCCCCACCTCTGCCCGGACATCCACCATGGGGACAGCCACCAGGAGG
AAGCCACACCTGCTGCTGGTAGCTGCTGTGGCCCTTGTCTCCTCTTCAGGTGAAGATACT
GAGGCTCAGAAGAGTTCTATAACTTTCCCAAGGTCCCACAGCTAGTAGAGGGCCAGCCTA
GTCCCCAGGCCCAGGCCTCGTTGGTCCACACTGCCCCAGTAAGGGTATTAGGCTCCAGGG
ACACACATCCTCTCTGCATGTTTGTGGCTGGCGACGTCTCATGCACCTCACACCCCACAG
ATCAGTTCTTCTCTTGGAGTTCAGCCCTGGGATCCCAAACCACCTTCGGGCCTGTCTTTG
AAGACCAGCCCCTCAGTGTGCTATTCCCAGAGGAGTCCACGGAGGAGCAGGTGTTGCTGG
CATGCCGCGCCCGGGCCAGCCCTCCAGCCACCTATCGGTGGAAGATGAATGGTACCGAGA
TGAAGCTGGAGCCAGGTTCCCGTCACCAGCTGGTGGGGGGCAACCTGGTCATCATGAACC
CCACCAAGGCACAGGATGCCGGGGTCTACCAGTGCCTGGCCTCCAACCCAGTGGGCACCG
TTGTCAGCAGGGAGGCCATCCTCCGCTTCGGCTTTCTGCAGGAATTCTCCAAGGAGGAGC
GAGACCCAGTGAAAGCTCATGAAGGCTGGGGGGTGATGTTGCCCTGTAACCCACCTGCCC
ACTACCCAGGCTTGTCCTACCGCTGGCTCCTCAACGAGTTCCCCAACTTCATCCCGACGG
ACGGGCGTCACTTCGTGTCCCAGACCACAGGGAACCTGTACATTGCCCGAACCAATGCCT
CAGACCTGGGCAACTACTCCTGTTTGGCCACCAGCCACATGGACTTCTCCACCAAGAGCG
TCTTCAGCAAGTTTGCTCAGCTCAACCTGGCTGCTGAAGATACCCGGCTCTTTGCACCCA
GCATCAAGGCCCGGTTCCCAGCAGAGACCTATGCACTGGTGGGGCAGCAGGTCACCCTGG
AGTGCTTCGCCTTTGGGAACCCTGTCCCCCGGATCAAGTGGCGCAAAGTGGACGGCTCCC
TGTCCCCGCAGTGGACCACAGCTGAGCCCACCCTGCAGATCCCCAGCGTCAGCTTTGAGG
ATGAGGGCACCTACGAGTGTGAGGCGGAGAACTCCAAGGGCCGAGACACCGTGCAGGGCC
GCATCATCGTGCAGGCTCAGCCTGAGTGGCTAAAAGTGATCTCGGACACAGAGGCTGACA
TTGGCTCCAACCTGCGTTGGGGCTGTGCAGCCGCCGGCAAGCCCCGGCCTACAGTGCGCT
GGCTGCGGAACGGGGAGCCTCTGGCCTCCCAGAACCGGGTGGAGGTGTTGGCTGGGGACC
TGCGGTTCTCCAAGCTGAGCCTGGAAGACTCGGGCATGTACCAGTGTGTGGCAGAGAATA
AGCACGGTACCATCTACGCCAGCGCCGAGCTAGCCGTGCAAGCACTCGCCCCTGACTTCA
GGCTGAATCCCGTGAGGCGTCTGATCCCCGCGGCCCGCGGGGGAGAGATCCTTATCCCCT
GCCAGCCCCGGGCAGCTCCAAAGGCCGTGGTGCTCTGGAGCAAAGGCACGGAGATTTTGG
TCAACAGCAGCAGAGTGACTGTAACTCCAGATGGCACCTTGATCATAAGAAACATCAGCC
GGTCAGATGAAGGCAAATACACCTGCTTTGCTGAGAACTTCATGGGCAAAGCCAACAGCA
CTGGAATCCTATCTGTGCGAGATGCAACCAAAATCACTCTAGCCCCCTCAAGTGCCGACA
TCAACTTGGGTGACAACCTGACCCTACAGTGCCATGCCTCCCACGACCCCACCATGGACC
TCACCTTCACCTGGACCCTGGACGACTTCCCCATCGACTTTGATAAGCCTGGAGGGCACT
ACCGGAGAACTAATGTGAAGGAGACCATTGGGGATCTGACCATCCTGAACGCCCAGCTGC
GCCATGGGGGGAAGTACACGTGCATGGCCCAGACGGTGGTGGACAGCGCGTCCAAGGAGG
CCACAGTCCTGGTCCGAGGTCCGCCAGGTCCCCCAGGAGGTGTGGTGGTGAGGGACATTG
GCGACACCACCATCCAGCTCAGCTGGAGCCGTGGCTTCGACAACCACAGCCCCATCGCTA
AGTACACCCTGCAAGCTCGCACTCCACCTGCAGGGAAGTGGAAGCAGGTTCGGACCAATC
CTGCAAACATCGAGGGCAATGCCGAGACTGCACAGGTGCTGGGCCTCACCCCCTGGATGG
ACTATGAGTTCCGGGTCATAGCCAGCAACATTCTGGGCACTGGGGAGCCTAGTGGGCCCT
CCAGCAAAATCCGGACCAGGGAAGCAGCCCCCTCGGTGGCACCCTCAGGACTCAGCGGAG
GAGGTGGAGCCCCCGGAGAGCTCATCGTCAACTGGACGCCCATGTCACGGGAGTACCAGA
ACGGAGACGGCTTCGGCTACCTGCTGTCCTTCCGCAGGCAGGGCAGCACTCACTGGCAGA
CCGCCCGGGTGCCTGGCGCCGATGCCCAGTACTTTGTCTACAGCAACGAGAGCGTCCGGC
CCTACACGCCCTTTGAGGTCAAGATCCGCAGCTACAACCGCCGCGGGGATGGGCCCGAGA
GCCTCACTGCACTCGTGTACTCAGCTGAGGAAGAGCCCAGGGTGGCCCCTACCAAGGTGT
GGGCCAAAGGGGTCTCATCCTCAGAGATGAACGTGACCTGGGAACCCGTGCAGCAGGACA
TGAATGGTATCCTCCTGGGGTATGAGATCCGCTACTGGAAAGCTGGGGACAAAGAAGCAG
CTGCGGACCGAGTGAGGACAGCAGGGCTGGACACCAGTGCCCGAGTCAGCGGCCTGCATC
CCAACACCAAGTACCATGTGACCGTGAGGGCCTACAACCGGGCTGGCACTGGGCCTGCCA
GCCCTTCTGCCAACGCCACGACCATGAAGCCCCCTCCGCGGCGACCTCCTGGCAACATCT
CCTGGACTTTCTCAAGCTCTAGTCTTAGCATTAAGTGGGACCCTGTGGTCCCTTTCCGAA
ATGAGTCTGCAGTCACCGGCTATAAGATGCTGTACCAGAATGACTTACACCTGACTCCCA
CGCTCCACCTCACCGGCAAGAACTGGATAGAAATCCCAGTGCCTGAAGACATTGGCCATG
CCCTGGTACAAATTCGGACCACAGGGCCCGGAGGGGATGGGATCCCTGCAGAAGTCCACA
TCGTGAGGAATGGAGGCACAAGCATGATGGTGGAGAACATGGCAGTCCGCCCAGCACCAC
ACCCTGGCACCGTCATTTCCCACTCCGTGGCGATGCTGATCCTCATAGGCTCCCTGGAGC
TCTGATCCTGGAACCCCTCCCTCTGCGCCGCAGCTGGACGCCACCTCCGACGGACACAGC
CAGCCCCTTCCTGCTGCCAAGGTGGCCTGACACTGTGCCAGAGAGTGGCTGGTTTTAAAT
ACCTACTTTAAACAGTGCCCTTTTTGTAGGAGGTAGGATATTTTATATTCTGCCGCAGGA
TAGAACCCACGCAAGGATTTTCTTTAAATTGAGAGGCACCAGGCAGTAACTTCCATGATG
ACACTGACGCCTATACCTGAGCTCTAGGCTGCCTGGAGGGAAGGAACAGGCCCATGGGAA
GAAGGGGGTTTTAAAAACATGTCTTCAACTCAGCAGAGATGGCCCTCTGGGACCCTATAC
GGACTCCGCCACTTGAGAGCAGTCCTAGGCCCGGCAGGAACACCAGACATGAACAGGTTG
AAGAACTGGAGCGAAGTGCACACCTCACCATCCTTCAGTCTAAGGAAGAAGGGCAAGCCC
TGGGACCAAGAGCTCTCCCGCCTTCTCCCTCGAGCAGCAGCAAGGACCCTGACGCTGTCC
CCGATAACTCCCTAGGGGCTCCTGCCTGCCCAAGCGGCTGAGAACCAGCGCCCCGATGCC
TGAGGCTGGGAGCCTGAGCCCCTTCAGCTTTGAGGGGGGTGATACTCCAGGCTGTTTGGG
GTGGGAGCCAAAAAGAGTTGAGAGGCCAGGGCCCTTGGTGGAAAGGGGCACCAGCCTTGG
TCTGAGATAGTCACAACCCAGGTGACGATGCCCTCTCAGCCAACACTGCCAACCTGACCC
TGTCATCCCGATTGACAGCGCCACTTCAGGTGGCTGGGTGACTAAAGGGCTTGTCTTGGT
GGGGTCTCCCACCCCTCCAAGACCCATTCTGCACAGTCCCTCCAGGGTTTGGGCAGGAGA
TGGCCAATCATGCGCCCACCTCTCCAGTGCTGCCTGCAGTCAGCTCGGCCTCCCCGACCT
GCAGCCCCAGACTCTGCTCTCCCAGCACTGACTCACTCCTGCCTGGGAGGGGAATGCAGC
ATTCATGCTGTGTGTCCTGGTATTGGGAGGTTTCTGGGAAGGGCAGAGGATAAATGTGGC
CCTGCCTGCTCCCAGGTATACCTAGGACCACCTGGCCAGATCCGCTCCCAGACGGCCTTG
GACTGCTTGCATTTCCCCGGAGAAAAAGGGGTTAATAAATGGGCCATCCTTTCCTGAGCT
CTGGGTATACTACCAGTCACAGAACGTCAGAGCTGGAAGAAGCCTTAGAGCTCAACTTCT
TCAAGCCCCTCACTTTACAGATGAGGAAATGGAGGTGGTCCAGAGAGGGTCTGGGATTCC
CAAGGTCACACAGCCCAGAAGAGATGGGGCTGGGTTAAGAACTCGAGTCTTCCACCTTTC
TGTTCAAGGCTGTTTGTCTACCCAGAGGAAGGAGGCACTGCTGAATGGCTATGGCCTGGC
TAAGAAGGTGATTAGTCAGTAGGGTGTGAAAATTCTACTTCAAGGGGTTCGGATTGGTGA
TCATGGGGATTGGCATGGCTGGGTTCCCGTCCAAGGTGTGGGCAGAGCTTCTACCAAACT
TCAACATGGAGGGCTGACTTGAAGCTCCCTGTCCCCCTCACTCTTGCCCCAAGAAAAGAG
GCCAAAGCAAGAGCAGATTCCCTAGGCAAGAGCAGCAGCACAACTAGGAAACCCCAAAGC
CCATGCTCCGACAGGTGGCCCTTCACAGGGGGCAGCGGGACAGGCATCTTGAAGGGCATA
TGTCCTCGGAAGCTCCGAGCCTGTTTTCTGTAGTTTATAGTTAGAGCTCTATTTTGTTAT
GGTTTTTTAAACTTTTAAGTCCTGCTCTATTTTCCTGGGCAGGTTTATGTTGATGTTTAC
CCACTACAATTTTTTAAAAATATAAGCTCACATGCCTTTTCCCTGCCACAGCCAAACCCC
CACTGCACCCTACCCACCCACCCCTAGCCCAGGTCAGCTTTCCTGGAGCTGGCTAATGAA
AGCCTCCTCACCTCTTCCCAACCCTTACAAGCAAGGGTGCTAGGGGCTCAGCTATACGAC
CATTCTCCCTGACAGGGAGTCCAAACTTGGCCTAGCATCCCTCCTGGCCCCCCTCTGGCC
ACGACTTGGCCTGTGCCTGGTTCTCTATCAGAAAGGGGATGCTGAACAAAACCTCCTTCC
AAGTTTTATCCAATTCGTTCCTCATTGCCTCGGGCTGCGTCAGGGGAAGCAGGGGACAGG
TGTCCAGTTGCTGGGCCGAGGGAGGAGCTGGTTTGGCATAGGACCTAACCAGTGAAGCTA
GAGGCTACAGCCACTAAACTTGCTTCAGGCCAACGATAGTTACTCACAAGTAAGTACCTT
AATGCTAATGAGGTCCACTAAAAAGGGGAGGAAGGCAGACCTCCTGGGAGACCCACGAAG
GGTTTTTAGCCAGGGAAAACTGAGCCCCAGGAAAACCTAACCACTGGGCAGGCAGAATTT
GTTTGAGGGATAGAACGACAACAAAATAAATGTTCCTGCAGCCTGAGATTTCAGGTAGAG
TACTGACTAAGGTTTAATAAGACAATAGGTGACCTGAGGACATGCAAGCTTGTAAAATGC
AACAGCCTCCTGCTAGAGTGACTTGTACATGAGCTTGCTTGCAGAAGACTAGATTAGATG
TTTCTCAGGATCCCCTCCTGCGCAGGGGTTCTCTGATTTTCGTGTTCTCTGCCCAGATGG
GCTGGGGGAGTTGAGAGTGTGCTTATTTTCACTGCGATCATGAGACCACAGTTCTGGGTT
ATCTCCTCTCATACATCAAGCCCCAGAGGAGGCGGCAAGAGGAACAGCCACAAACAAGTA
CTTTACCCCACAGCTTAGTGGCCAGTAAACACCCTGGGGACTAGGAAAAGGAACCAACTG
TAGGCACCTCTCCAGGGCCTAGGGAGACAAGTGTCCTCTCTTCTGCATACATTTGGGCTC
CCCTTACAGAGCCCTTTGCCCTGGCTCTCTGGTCCTTGTTGCTCTAACAGTCCAGATGTA
CACCCAGCCTCAGGGGGAAGGCAGCTCTCTCCAGACAGAGTCTCAGGGCCCAGCAAGGTC
AGGTTATCTGCTTTCATTCAGGGCAACAAATGATACAAATGGTGCCAGGGAGTGGCAAGG
CCATGGGGGTAGGTGGGGGTGTCTTTTTCTTTTCATAAAGTAACAACAGACGAGACTGAG
GTTAAACATCAGAAAAAAACCTCTGGAATGACCTTCCTCATTCCAGGAGGCCCTGGAATA
AGGAAGAGGCTTCTTTCTGAGGGAGCTTTGAGGAATTTTGACAGCTGTTGACATGGGATT
TGGGAAAGGTGAAGCTGTGACTGGAGGGGCAGGAGATGGTCCAAGTGTCCATCCAGAGAT
GAGACTCTTAGAATCAAAGTGTTCAGCCCAGGAAGTCTTGGAGATCCCACCTTCTGTGGC
CCTGCACCTTATGGGAAGCCATTAAGGGGGCTCATCTAGGAATTCTGGTTACAGCCCAGT
GCTCATCCCAGCGTATGCTGCCTCTTTAGGGCAGCCCCAAGGGCCAGCCAGCCTGTACTC
TGGGCAAGAGCCCAAAATGGCTAGGAATGTTTGACTCCCTTAATCTCTTCCCCAGCTACA
GAGGAATCTTTTCTCTGCCTGGTCTCAGAATGGGACTGCCAACTGGCTCATTGGTGGGAG
ACACAGTATCCTCAAACCTGTGGCCACTGGCATGACAGTGGTGCTCTGTCTCCCTGGGTG
ACACCCACCCTAGGCTTCCTCCTGGATGTGATGGGGATTGCCAGAGAGGCTCTTAGCATA
AAAGGCATTAGGTGGGCATTTTTCTGTGTGCCCCCAAAAAGCTCCATGGAAACAGGCACC
TGGTAGCTGCGGAACACCCGTGGACTTGTGTATATGGTCATAGGCTTTGGGAAGACAGGA
CGTAAAGGAAAATGAGAGAAACAAAATGGGTCAGATAGCTTTGGCCACAGCCCCAGGCAG
CCTTTGGGGCCTATGACACTTAGTGCCCTTAGATGGGATACATCTTGCCTCGGCCCCAAG
ACTCCTCCAACTTACCCGTCCCATCCAGGGCCTGCACAGCTTAGAGAGGCTCACAGCTTG
GCAAATGCTAGGGCTTCATCAGACCACTGACTTGACTCAGTGTTTGTTAAAATGGAACCA
CTCCCGTTGGCCTACTGTTTCTCTCCTGTACTTCTTGTAATGATAGTTATTTATTGACTC
TGGTAGCAGGCAGTTCTTAAATAAAGATGGTTTCTCAACCTGTTGGGGAAGCTGGCACGA

Protein Sequence

>6900 : length: 1040
MGTATRRKPHLLLVAAVALVSSSAWSSALGSQTTFGPVFEDQPLSVLFPEESTEEQVLLA
CRARASPPATYRWKMNGTEMKLEPGSRHQLVGGNLVIMNPTKAQDAGVYQCLASNPVGTV
VSREAILRFGFLQEFSKEERDPVKAHEGWGVMLPCNPPAHYPGLSYRWLLNEFPNFIPTD
GRHFVSQTTGNLYIARTNASDLGNYSCLATSHMDFSTKSVFSKFAQLNLAAEDTRLFAPS
IKARFPAETYALVGQQVTLECFAFGNPVPRIKWRKVDGSLSPQWTTAEPTLQIPSVSFED
EGTYECEAENSKGRDTVQGRIIVQAQPEWLKVISDTEADIGSNLRWGCAAAGKPRPTVRW
LRNGEPLASQNRVEVLAGDLRFSKLSLEDSGMYQCVAENKHGTIYASAELAVQALAPDFR
LNPVRRLIPAARGGEILIPCQPRAAPKAVVLWSKGTEILVNSSRVTVTPDGTLIIRNISR
SDEGKYTCFAENFMGKANSTGILSVRDATKITLAPSSADINLGDNLTLQCHASHDPTMDL
TFTWTLDDFPIDFDKPGGHYRRTNVKETIGDLTILNAQLRHGGKYTCMAQTVVDSASKEA
TVLVRGPPGPPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTNP
ANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREAAPSVAPSGLSGG
GGAPGELIVNWTPMSREYQNGDGFGYLLSFRRQGSTHWQTARVPGADAQYFVYSNESVRP
YTPFEVKIRSYNRRGDGPESLTALVYSAEEEPRVAPTKVWAKGVSSSEMNVTWEPVQQDM
NGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPAS
PSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPT
LHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAPH
PGTVISHSVAMLILIGSLEL