ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6888

Name

TALDO1

Synonym

TAL|TAL-H|TALDOR|TALH;transaldolase 1;TALDO1;transaldolase 1

Definition

dihydroxyacetone transferase|glycerone transferase|transaldolase

Position

11p15.5-p15.4

Gene Type

protein-coding

Pathways and Diseases

Pathway

Integration of energy metabolism;Reactome;REACT:1505

Pathway

Pentose phosphate pathway;PANTHER;P02762

Pathway

pentose phosphate pathway (non-oxidative branch);BioCyc;NONOXIPENT-PWY

Pathway

Metabolic pathways;KEGG PATHWAY;hsa01100

Pathway

Insulin effects increased synthesis of Xylulose-5-Phosphate;PID Reactome;500718

Pathway

Pentose phosphate pathway (hexose monophosphate shunt);PID Reactome;500683

Pathway

pentose phosphate pathway;BioCyc;PENTOSE-P-PWY

Pathway

Metabolism of carbohydrates;Reactome;REACT:474

Pathway

Pentose phosphate pathway;KEGG PATHWAY;hsa00030

Disease

Transaldolase deficiency;OMIM

External Links

Links to cell senescence gene database

6888

Links to epithelial mesenchymal transition gene database

6888

Links to ovarian cancer gene database

6888

Links to endometrial cancer gene database

6888

Links to iHOP

6888

Sequence Information

Nucleotide Sequence

>6888 : length: 1319
CGCGCCCGTCCCGTCGCCGCCGCCGCCGCCGCAGACCCCTCGGTCTTGCTATGTCGAGCT
CACCCGTGAAGCGTCAGAGGATGGAGTCCGCGCTGGACCAGCTCAAGCAGTTCACCACCG
TGGTGGCCGACACGGGCGACTTCCACGCCATCGACGAGTACAAGCCCCAGGATGCTACCA
CCAACCCGTCCCTGATCCTGGCCGCAGCACAGATGCCCGCTTACCAGGAGCTGGTGGAGG
AGGCGATTGCCTATGGCCGGAAGCTGGGCGGGTCACAAGAGGACCAGATTAAAAATGCTA
TTGATAAACTTTTTGTGTTGTTTGGAGCAGAAATACTAAAGAAGATTCCGGGCCGAGTAT
CCACAGAAGTAGACGCAAGGCTCTCCTTTGATAAAGATGCGATGGTGGCCAGAGCCAGGC
GGCTCATCGAGCTCTACAAGGAAGCTGGGATCAGCAAGGACCGAATTCTTATAAAGCTGT
CATCAACCTGGGAAGGAATTCAGGCTGGAAAGGAGCTCGAGGAGCAGCACGGCATCCACT
GCAACATGACGTTACTCTTCTCCTTCGCCCAGGCTGTGGCCTGTGCCGAGGCGGGTGTGA
CCCTCATCTCCCCATTTGTTGGGCGCATCCTTGATTGGCATGTGGCAAACACCGACAAGA
AATCCTATGAGCCCCTGGAAGACCCTGGGGTAAAGAGTGTCACTAAAATCTACAACTACT
ACAAGAAGTTTAGCTACAAAACCATTGTCATGGGCGCCTCCTTCCGCAACACGGGCGAGA
TCAAAGCACTGGCCGGCTGTGACTTCCTCACCATCTCACCCAAGCTCCTGGGAGAGCTGC
TGCAGGACAACGCCAAGCTGGTGCCTGTGCTCTCAGCCAAGGCGGCCCAAGCCAGTGACC
TGGAAAAAATCCACCTGGATGAGAAGTCTTTCCGTTGGTTGCACAACGAGGACCAGATGG
CTGTGGAGAAGCTCTCTGACGGGATCCGCAAGTTTGCCGCTGATGCAGTGAAGCTGGAGC
GGATGCTGACAGAACGAATGTTCAATGCAGAGAATGGAAAGTAGCGCATCCCTGAGGCTG
GACTCCAGATCTGCACCGCCGGCCAGCTGGGATCTGACTGCACGTGGCTTCTGATGAATC
TTGCGTTTTTTACAAATTGGAGCAGGGACAGATCATAGATTTCTGATTTTATGTAAAATT
TTGCCTAATACATTAAAGCAGTCACTTTTCCTGTGCTGTTTCAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>6888 : length: 337
MSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQE
LVEEAIAYGRKLGGSQEDQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVA
RARRLIELYKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAE
AGVTLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYKTIVMGASFRN
TGEIKALAGCDFLTISPKLLGELLQDNAKLVPVLSAKAAQASDLEKIHLDEKSFRWLHNE
DQMAVEKLSDGIRKFAADAVKLERMLTERMFNAENGK