ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6887

Name

TAL2

Synonym

T-cell acute lymphocytic leukemia 2;TAL2;T-cell acute lymphocytic leukemia 2

Definition

T-cell acute lymphocytic leukemia protein 2|TAL-2|class A basic helix-loop-helix protein 19

Position

9q32

Gene Type

protein-coding

External Links

Links to cell senescence gene database

6887

Links to epithelial mesenchymal transition gene database

6887

Links to ovarian cancer gene database

6887

Links to endometrial cancer gene database

6887

Links to iHOP

6887

Sequence Information

Nucleotide Sequence

>6887 : length: 656
CCCTGAGGGCCCTTTCTCTTTCCATCTCAGGAACTCAAACATGACCAGGAAGATCTTCAC
AAATACCAGGGAGCGGTGGAGGCAGCAGAATGTCAACAGCGCCTTTGCCAAGCTGAGGAA
GCTCATCCCCACTCACCCTCCAGACAAAAAGCTGAGCAAAAATGAAACGCTTCGCCTGGC
AATGAGGTATATCAACTTCTTGGTCAAGGTCTTGGGGGAGCAAAGCCTGCAACAAACGGG
AGTGGCTGCTCAGGGGAACATTCTGGGGCTCTTCCCTCAAGGACCCCACCTGCCAGGCCT
GGAGGACAGAACTCTGCTTGAGAACTACCAGGTTCCTTCACCTGGTCCAAGCCACCACAT
TCCTTAGTGTGGCTCTGGCTGTCATCTCCCAGGGCAGCACTTGCCCAGAAATCACTGCCT
GTGGACAGACTTTTGCATGTTCCAGAGTTGACCTGATGATAACTCGTGAAGCATGAATTC
TAGCTTCCTGGGAGGTGGCTCAGAGACAGCTGCAGGGAGCTGAAAGAAGCCATGAGGAAT
GTCACTTGTGGGCCGCCACCCCCCAGGGATGTCAGGTAGAGCGGCCTACCTCTGCCTATT
TTAAATCCAGGTTCTGCATAAGACTTTTGGAGAAAAAATTCTAAATAAAAAAAAAA

Protein Sequence

>6887 : length: 108
MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGE
QSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP