ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6885

Name

MAP3K7

Synonym

MEKK7|TAK1|TGF1a;mitogen-activated protein kinase kinase kinase 7;MAP3K7;mitogen-activated protein kinase kinase kinase 7

Definition

TGF-beta activated kinase 1|TGF-beta-activated kinase 1|transforming growth factor-beta-activated kinase 1

Position

6q15

Gene Type

protein-coding

Pathways and Diseases

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

nfkb activation by nontypeable hemophilus influenzae;PID BioCarta;100088

Pathway

thrombin signaling and protease-activated receptors;PID BioCarta;100082

Pathway

alk in cardiac myocytes;PID BioCarta;100244

Pathway

RIG-I-like receptor signaling pathway;KEGG PATHWAY;hsa04622

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Downstream TCR signaling;PID Reactome;500482

Pathway

tgf beta signaling pathway;PID BioCarta;100017

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

TNF receptor signaling pathway;PID Curated;200086

Pathway

BMP receptor signaling;PID Curated;200123

Pathway

mapkinase signaling pathway;PID BioCarta;100113

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

Pathway

TGF-beta receptor signaling;PID Curated;200195

Pathway

nf-kb signaling pathway;PID BioCarta;100097

Pathway

Ephrin B reverse signaling;PID Curated;200173

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

fas signaling pathway (cd95);PID BioCarta;100167

Pathway

JNK signaling in the CD4+ TCR pathway;PID Curated;200129

Pathway

wnt signaling pathway;PID BioCarta;100002

Pathway

Noncanonical Wnt signaling pathway;PID Curated;200016

Pathway

TRAF6 Mediated Induction of the antiviral cytokine IFN-alpha/beta cascade;PID Reactome;500449

Pathway

IL1-mediated signaling events;PID Curated;200075

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

p38 MAPK signaling pathway;PID Curated;200014

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Interleukin-1 signaling;PID Reactome;500490

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Disease

IMMUNE;GAD

Disease

Celiac Disease;GAD

Disease

smoking cessation;GAD

Disease

CHEMDEPENDENCY;GAD

External Links

Links to cell senescence gene database

6885

Links to epithelial mesenchymal transition gene database

6885

Links to ovarian cancer gene database

6885

Links to endometrial cancer gene database

6885

Links to iHOP

6885

Sequence Information

Nucleotide Sequence

>6885 : length: 5172
GTCCTCTCTCGCGGTATCATCCGGTTGCTGAGGCCCTGTAATAAAGGTCTCGCGAAATTT
GTTCTAGAGGTCCAAGTTTGCTTCTTAGCTTACTCCACCCCACCCCCAACCTGTCCCTCC
TTTTCTTTCCAAGTCACAAAATTCTCCCCTCCCCTACCCCGGAGTTTACGGCCCTCCTCC
TGTTTCCGATTTCAGCCCGGAACCGGAAGTGTAGTGGGCGGGGCCCGTCGGCGGAAAACG
CAGCGGAGCCAGAGCCGGACACGGCTGTGGCCGCTGCCTCTACCCCCGCCACGGATCGCC
GGGTAGTAGGACTGCGCGGCTCCAGGCTGAGGGTCGGTCCGGAGGCGGGTGGGCGCGGGT
CTCACCCGGATTGTCCGGGTGGCACCGTTCCCGGCCCCACCGGGCGCCGCGAGGGATCAT
GTCTACAGCCTCTGCCGCCTCCTCCTCCTCCTCGTCTTCGGCCGGTGAGATGATCGAAGC
CCCTTCCCAGGTCCTCAACTTTGAAGAGATCGACTACAAGGAGATCGAGGTGGAAGAGGT
TGTTGGAAGAGGAGCCTTTGGAGTTGTTTGCAAAGCTAAGTGGAGAGCAAAAGATGTTGC
TATTAAACAAATAGAAAGTGAATCTGAGAGGAAAGCGTTTATTGTAGAGCTTCGGCAGTT
ATCCCGTGTGAACCATCCTAATATTGTAAAGCTTTATGGAGCCTGCTTGAATCCAGTGTG
TCTTGTGATGGAATATGCTGAAGGGGGCTCTTTATATAATGTGCTGCATGGTGCTGAACC
ATTGCCATATTATACTGCTGCCCACGCAATGAGTTGGTGTTTACAGTGTTCCCAAGGAGT
GGCTTATCTTCACAGCATGCAACCCAAAGCGCTAATTCACAGGGACCTGAAACCACCAAA
CTTACTGCTGGTTGCAGGGGGGACAGTTCTAAAAATTTGTGATTTTGGTACAGCCTGTGA
CATTCAGACACACATGACCAATAACAAGGGGAGTGCTGCTTGGATGGCACCTGAAGTTTT
TGAAGGTAGTAATTACAGTGAAAAATGTGACGTCTTCAGCTGGGGTATTATTCTTTGGGA
AGTGATAACGCGTCGGAAACCCTTTGATGAGATTGGTGGCCCAGCTTTCCGAATCATGTG
GGCTGTTCATAATGGTACTCGACCACCACTGATAAAAAATTTACCTAAGCCCATTGAGAG
CCTGATGACTCGTTGTTGGTCTAAAGATCCTTCCCAGCGCCCTTCAATGGAGGAAATTGT
GAAAATAATGACTCACTTGATGCGGTACTTTCCAGGAGCAGATGAGCCATTACAGTATCC
TTGTCAGTATTCAGATGAAGGACAGAGCAACTCTGCCACCAGTACAGGCTCATTCATGGA
CATTGCTTCTACAAATACGAGTAACAAAAGTGACACTAATATGGAGCAAGTTCCTGCCAC
AAATGATACTATTAAGCGCTTAGAATCAAAATTGTTGAAAAATCAGGCAAAGCAACAGAG
TGAATCTGGACGTTTAAGCTTGGGAGCCTCCCGTGGGAGCAGTGTGGAGAGCTTGCCCCC
AACCTCTGAGGGCAAGAGGATGAGTGCTGACATGTCTGAAATAGAAGCTAGGATCGCCGC
AACCACAGCCTATTCCAAGCCTAAACGGGGCCACCGTAAAACTGCTTCATTTGGCAACAT
TCTGGATGTCCCTGAGATCGTCATATCAGGCAACGGACAGCCAAGACGTAGATCCATCCA
AGACTTGACTGTAACTGGAACAGAACCTGGTCAGGTGAGCAGTAGGTCATCCAGTCCCAG
TGTCAGAATGATTACTACCTCAGGACCAACCTCAGAAAAGCCAACTCGAAGTCATCCATG
GACCCCTGATGATTCCACAGATACCAATGGATCAGATAACTCCATCCCAATGGCTTATCT
TACACTGGATCACCAACTACAGCCTCTAGCACCGTGCCCAAACTCCAAAGAATCTATGGC
AGTGTTTGAACAGCATTGTAAAATGGCACAAGAATATATGAAAGTTCAAACAGAAATTGC
ATTGTTATTACAGAGAAAGCAAGAACTAGTTGCAGAACTGGACCAGGATGAAAAGGACCA
GCAAAATACATCTCGCCTGGTACAGGAACATAAAAAGCTTTTAGATGAAAACAAAAGCCT
TTCTACTTACTACCAGCAATGCAAAAAACAACTAGAGGTCATCAGAAGTCAGCAGCAGAA
ACGACAAGGCACTTCATGATTCTCTGGGACCGTTACATTTTGAAATATGCAAAGAAAGAC
TTTTTTTTTAAGGAAAGGAAAACCTTATAATGACGATTCATGAGTGTTAGCTTTTTGGCG
TGTTCTGAATGCCAACTGCCTATATTTGCTGCATTTTTTTCATTGTTTATTTTCCTTTTC
TCATGGTGGACATACAATTTTACTGTTTCATTGCATAACATGGTAGCATCTGTGACTTGA
ATGAGCAGCACTTTGCAACTTCAAAACAGATGCAGTGAACTGTGGCTGTATATGCATGCT
CATTGTGTGAAGGCTAGCCTAACAGAACAGGAGGTATCAAACTAGCTGCTATGTGCAAAC
AGCGTCCATTTTTTCATATTAGAGGTGGAACCTCAAGAATGACTTTATTCTTGTATCTCA
TCTCAAAATATTAATAATTTTTTTCCCAAAAGATGGTATATACCAAGTTAAAGACAGGGT
ATTATAAATTTAGAGTGATTGGTGGTATATTACGGAAATACGGAACCTTTAGGGATAGTT
CCGTGTAAGGGCTTTGATGCCAGCATCCTTGGATCAGTACTGAACTCAGTTCCATCCGTA
AAATATGTAAAGGTAAGTGGCAGCTGCTCTATTTAATGAAAGCAGTTTTACCGGATTTTG
TTAGACTAAAATTTGATTGTGATACATTGAACAAAATGGAACTCATTTTTTTTTAAGGAG
TAAAGATTTTTAATTCTGTGATTGTGTGTATGTGTGTTGAAACTGTAAAGCTTTTATGAC
TCTAATATTAATCTCTTAAATGAAATTAAAAGGCAAAAGAACATGATTGAGCTTAAATGA
TCATTTCTTCCTGCAGTGATTCTTGGATTGTTTTCTCATGTATTTGAAAAAAAAAAAATG
AAGAAAAATAATGGAAAATGGAAGTAATTACTCCAGCTAAAAAAAGCTTGGACTTAGATT
TCTTTTTATGATACCAAATGAGAAATAAACCAGGCAAATCAGAAGGAAGTTAAAGAAGCA
AATATAAATTCAACAAGTGTCCTAATTATCCTGGATATTGGAATATTTGATTTTCCTTAC
AATCCCGTTCTAGAATGCCTGCCGCCTTTCAACACTTTCAAGAGAATTTCAACACTTACA
GAGTATTTATATTGTTAACAGTAATTTTGCTACCAAAACCTTCAGAATAACTTTAATAAT
AAAATGACACTGAAATAATAGACTATACAAACTCTATATTTTTTCAGTTGGTGTTAAAAT
AAGTCACATTTTGATACCAGTACAAGATGTCTTTTAAATAAGGATGTCATCAGTCTGATT
TTTATAGCATTAATGTTTTATGAAGAAAAAGTTCAAAATGAAAGCATTAATTGCTGTGAT
TATTAGAATTCTATCATGACTGTATTGTAGTTTTTGCTCTATTTCAGATAAGCAAGATCT
AAGAAGTTATCAAAACTATTCTTTAAAATGCTAAAGCAGGTAACTTTTTCTTCCATTATT
TTTTCCTCCTACCACTGAGTTTTGTAATGAATTCCTTGTGTATACAAGCAATACAGGTGA
ATACTAAACTGTTATTTTTAGCTTCTTCAAAAGCTATTTTAGAAAGCTTCCTGGAAATAA
ATGTCTTCTGTCATTTAATTTAAATAAAAGGAGTGTTAATTGTTCCCAAATTTGATTACC
TAGCTGAAACAGATATTGGATTCAGCATAGTAATAGTAAAATAAAATTGGCAGAGAAAAT
AACTGTAGACTAGGATAAAGCATGACTCCTCCATAGCATTGTTGCTTGTATGTACATCTG
TCACTCCACTGAAAGGGACCTAGTCACTTTAAAGAGGCCTTTTATCTCAGCACGAGATAT
CCAAGCGTGAATGCTAAGGCTTGATGTTTCCATTAGGATTTAGCATTCGAGATTTCAGAT
TTTATTTATAGTCATTGATGTGTTTTGCTGTATTATAACACATTTAAGGGAAATTTTATT
ATGGTTTTTACATGTAGTCATTTCATAAAAATATCCAGATAGGTAAATGGAAGAAAATAG
TAGATTTTAGTCATGGTACCAAATGCAAGAGGCTGTTGAACAGTTGCTTGTTTGTTTACA
GTAAGTTCCTTGAGATTTTCAGTACTGTAGTTGCCCTGGACATTGAGTACAGTTCAGCCT
TACTCTGTTTTTAAGTAGTTGTGTTGTCAATTTCATGCTTTTAAGTCCTGATGATCCTTG
GAGATGGGAGAAAAAGATACCAGGGATAATTAAAATCCACAGCCAGTTTCATCAGTTTCC
TCATCCATCCTGCAAATAAAAATGTTAACAAGGAGCCAAACTTATTCGTTCTGGTTTTAC
AATTTATTTTGACCGTTTTTTGGGTGAAAATTGCAAACAGCCAAGCAAGTGGCTGGAATG
CCCCAGTCTAAGAAATTCAAAAACAATCACTGAGTAAGCCCTAATTACATTAATTACATT
TTACTCTTGACTCCAGGAAAAGAAAGCAAGCTTTTATCTAATCTAGAGGGAAGTATTCGT
GAGCAATAAAAATCACTTTTTTGAGTTGAATAATAATCAGTTAAGAATATTTACCGCATA
GCAACACAACATATAAAGATTTGTTACAAGTTGTTTACGGATGTTTGACTATTTTTGCTG
AAGTATTTTAGAGTATTGAATGTCTTCTCTCTTCAAGTTTCTTTCATGTTCCTAATTTCA
GCTCCTGTAGCCAGAGATCACAGGTCTTCCCTGTGAAACTTTGGTTTCTTTCTATAAATG
TGTGTGGTTTTCAGCGCTCAACTCCTGTCTTCAAATGGTAGTAAGTTCTACTTCTACTTC
TGTCATTCAGAACATTTTATGTCAAATGATGTAATGCAGAAATTCTTGTGCATATTTGTA
ACTGAAGGAAGCTTTTTAGATTTATTTTTGTTTTTAATAAAATTCAGATTCCTATTCTAA
ACTGGTAAAAAA

Protein Sequence

>6885 : length: 606
MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHP
WTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI
ALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS