ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

688

Name

KLF5

Synonym

BTEB2|CKLF|IKLF;Kruppel-like factor 5 (intestinal);KLF5;Kruppel-like factor 5 (intestinal)

Definition

BTE-binding protein 2|GC box binding protein 2|Klf5C isoform|Krueppel-like factor 5|basic transcription element binding protein 2|colon krueppel-like factor|colon kruppel-like factor|intestinal-enriched krueppel-like factor|intestinal-enriched kruppel-lik

Position

13q22.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

688

Links to epithelial mesenchymal transition gene database

688

Links to ovarian cancer gene database

688

Links to endometrial cancer gene database

688

Links to iHOP

688

Sequence Information

Nucleotide Sequence

>688 : length: 3583
GCGGCCGCCCTGCGCGCGAAGCTCGTGGCCCGAGAGGGGTGCGGTCGGGCCGACGGAGGC
GGGGCCCTGGCTGCCTCTCTCCCTGCTCATAGGCTGGCCGCTCAGGCCTGGCCGGCCTCG
GGGCCTCGGGATTCGCGGCGGCGCTGCCAATCAGGCGATCGGGCCCCGCCCCCCCGGAGT
TGGGTGAAATAGAGGCGGGCGTCAAGTGTCAGTAGTCGCGGGGCAGGTACGTGCGCTCGC
GGTTCTCTCGCGGAGGTCGGCGGTGGCGGGAGCGGGCTCCGGAGAGCCTGAGAGCACGGT
GGGGCGGGGCGGGAGAAAGTGGCCGCCCGGAGGACGTTGGCGTTTACGTGTGGAAGAGCG
GAAGAGTTTTGCTTTTCGTGCGCGCCTTCGAAAACTGCCTGCCGCTGTCTGAGGAGTCCA
CCCGAAACCTCCCCTCCTCCGCCGGCAGCCCCGCGCTGAGCTCGCCGACCCAAGCCAGCG
TGGGCGAGGTGGGAAGTGCGCCCGACCCGCGCCTGGAGCTGCGCCCCCGAGTGCCCATGG
CTACAAGGGTGCTGAGCATGAGCGCCCGCCTGGGACCCGTGCCCCAGCCGCCGGCGCCGC
AGGACGAGCCGGTGTTCGCGCAGCTCAAGCCGGTGCTGGGCGCCGCGAATCCGGCCCGCG
ACGCGGCGCTCTTCCCCGGCGAGGAGCTGAAGCACGCGCACCACCGCCCGCAGGCGCAGC
CCGCGCCCGCGCAGGCCCCGCAGCCGGCCCAGCCGCCCGCCACCGGCCCGCGGCTGCCTC
CAGAGGACCTGGTCCAGACAAGATGTGAAATGGAGAAGTATCTGACACCTCAGCTTCCTC
CAGTTCCTATAATTCCAGAGCATAAAAAGTATAGACGAGACAGTGCCTCAGTCGTAGACC
AGTTCTTCACTGACACTGAAGGGTTACCTTACAGTATCAACATGAACGTCTTCCTCCCTG
ACATCACTCACCTGAGAACTGGCCTCTACAAATCCCAGAGACCGTGCGTAACACACATCA
AGACAGAACCTGTTGCCATTTTCAGCCACCAGAGTGAAACGACTGCCCCTCCTCCGGCCC
CGACCCAGGCCCTCCCTGAGTTCACCAGTATATTCAGCTCACACCAGACCGCAGCTCCAG
AGGTGAACAATATTTTCATCAAACAAGAACTTCCTACACCAGATCTTCATCTTTCTGTCC
CTACCCAGCAGGGCCACCTGTACCAGCTACTGAATACACCGGATCTAGATATGCCCAGTT
CTACAAATCAGACAGCAGCAATGGACACTCTTAATGTTTCTATGTCAGCTGCCATGGCAG
GCCTTAACACACACACCTCTGCTGTTCCGCAGACTGCAGTGAAACAATTCCAGGGCATGC
CCCCTTGCACATACACAATGCCAAGTCAGTTTCTTCCACAACAGGCCACTTACTTTCCCC
CGTCACCACCAAGCTCAGAGCCTGGAAGTCCAGATAGACAAGCAGAGATGCTCCAGAATT
TAACCCCACCTCCATCCTATGCTGCTACAATTGCTTCTAAACTGGCAATTCACAATCCAA
ATTTACCCACCACCCTGCCAGTTAACTCACAAAACATCCAACCTGTCAGATACAATAGAA
GGAGTAACCCCGATTTGGAGAAACGACGCATCCACTACTGCGATTACCCTGGTTGCACAA
AAGTTTATACCAAGTCTTCTCATTTAAAAGCTCACCTGAGGACTCACACTGGTGAAAAGC
CATACAAGTGTACCTGGGAAGGCTGCGACTGGAGGTTCGCGCGATCGGATGAGCTGACCC
GCCACTACCGGAAGCACACAGGCGCCAAGCCCTTCCAGTGCGGGGTGTGCAACCGCAGCT
TCTCGCGCTCTGACCACCTGGCCCTGCATATGAAGAGGCACCAGAACTGAGCACTGCCCG
TGTGACCCGTTCCAGGTCCCCTGGGCTCCCTCAAATGACAGACCTAACTATTCCTGTGTA
AAAACAACAAAAACAAACAAAAGCAAGAAAACCACAACTAAAACTGGAAATGTATATTTT
GTATATTTGAGAAAACAGGGAATACATTGTATTAATACCAAAGTGTTTGGTCATTTTAAG
AATCTGGAATGCTTGCTGTAATGTATATGGCTTTACTCAAGCAGATCTCATCTCATGACA
GGCAGCCACGTCTCAACATGGGTAAGGGGTGGGGGTGGAGGGGAGTGTGTGCAGCGTTTT
TACCTAGGCACCATCATTTAATGTGACAGTGTTCAGTAAACAAATCAGTTGGCAGGCACC
AGAAGAAGAATGGATTGTATGTCAAGATTTTACTTGGCATTGAGTAGTTTTTTTCAATAG
TAGGTAATTCCTTAGAGATACAGTATACCTGGCAATTCACAAATAGCCATTGAACAAATG
TGTGGGTTTTTAAAAATTATATACATATATGAGTTGCCTATATTTGCTATTCAAAATTTT
GTAAATATGCAAATCAGCTTTATAGGTTTATTACAAGTTTTTTAGGATTCTTTTGGGGAA
GAGTCATAATTCTTTTGAAAATAACCATGAATACACTTACAGTTAGGATTTGTGGTAAGG
TACCTCTCAACATTACCAAAATCATTTCTTTAGAGGGAAGGAATAATCATTCAAATGAAC
TTTAAAAAAGCAAATTTCATGCACTGATTAAAATAGGATTATTTTAAATACAAAAGGCAT
TTTATATGAATTATAAACTGAAGAGCTTAAAGATAGTTACAAAATACAAAAGTTCAACCT
CTTACAATAAGCTAAACGCAATGTCATTTTTAAAAAGAAGGACTTAGGGTGTCGTTTTCA
CATATGACAATGTTGCATTTATGATGCAGTTTCAAGTACCAAAACGTTGAATTGATGATG
CAGTTTTCATATATCGAGATGTTCGCTCGTGCAGTACTGTTGGTTAAATGACAATTTATG
TGGATTTTGCATGTAATACACAGTGAGACACAGTAATTTTATCTAAATTACAGTGCAGTT
TAGTTAATCTATTAATACTGACTCAGTGTCTGCCTTTAAATATAAATGATATGTTGAAAA
CTTAAGGAAGCAAATGCTACATATATGCAATATAAAATAGTAATGTGATGCTGATGCTGT
TAACCAAAGGGCAGAATAAATAAGCAAAATGCCAAAAGGGGTCTTAATTGAAATGAAAAT
TTAATTTTGTTTTTAAAATATTGTTTATCTTTATTTATTTTGTGGTAATATAGTAAGTTT
TTTTAGAAGACAATTTTCATAACTTGATAAATTATAGTTTTGTTTGTTAGAAAAGTTGCT
CTTAAAAGATGTAAATAGATGACAAACGATGTAAATAATTTTGTAAGAGGCTTCAAAATG
TTTATACGTGGAAACACACCTACATGAAAAGCAGAAATCGGTTGCTGTTTTGCTTCTTTT
TCCCTCTTATTTTTGTATTGTGGTCATTTCCTATGCAAATAATGGAGCAAACAGCTGTAT
AGTTGTAGAATTTTTTGAGAGAATGAGATGTTTATATATTAACGACAATTTTTTTTTTGG
AAAATAAAAAGTGCCTAAAAGATGTAAAAAAAAAAAAAAAAAA

Protein Sequence

>688 : length: 457
MATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFPGEELKHAHHRPQA
QPAPAQAPQPAQPPATGPRLPPEDLVQTRCEMEKYLTPQLPPVPIIPEHKKYRRDSASVV
DQFFTDTEGLPYSINMNVFLPDITHLRTGLYKSQRPCVTHIKTEPVAIFSHQSETTAPPP
APTQALPEFTSIFSSHQTAAPEVNNIFIKQELPTPDLHLSVPTQQGHLYQLLNTPDLDMP
SSTNQTAAMDTLNVSMSAAMAGLNTHTSAVPQTAVKQFQGMPPCTYTMPSQFLPQQATYF
PPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYN
RRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDEL
TRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN