ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6872

Name

TAF1

Synonym

BA2R|CCG1|CCGS|DYT3|DYT3/TAF1|KAT4|N-TAF1|NSCL2|OF|P250|TAF(II)250|TAF2A|TAFII-250|TAFII250|XDP;TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250kDa;TAF1;TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250kDa

Definition

TBP-associated factor 250 kDa|cell cycle gene 1 protein|cell cycle, G1 phase defect|complementation of cell cycle block, G1-to-S|transcription factor TFIID p250 polypeptide|transcription initiation factor TFIID subunit 1

Position

Xq13.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Regulation of retinoblastoma protein;PID Curated;200191

Pathway

hypoxia and p53 in the cardiovascular system;PID BioCarta;100084

Pathway

Basal transcription factors;KEGG PATHWAY;hsa03022

Pathway

Transcription;Reactome;REACT:1788

Pathway

HIV Infection;Reactome;REACT:6185

Pathway

Gene Expression;Reactome;REACT:71

Disease

Thrombin activatable fibrinolysis inhibitor;GAD

Disease

microangiopathy, thrombotic;GAD

Disease

atherothrombosis;GAD

Disease

HEMATOLOGICAL;GAD

Disease

atherosclerosis, coronary;GAD

Disease

CARDIOVASCULAR;GAD

Disease

meningococcal disease;GAD

Disease

Dystonia-Parkinsonism, X-linked;OMIM

Disease

angina;GAD

Disease

blood pressure;GAD

Disease

INFECTION;GAD

External Links

Links to cell senescence gene database

6872

Links to epithelial mesenchymal transition gene database

6872

Links to ovarian cancer gene database

6872

Links to endometrial cancer gene database

6872

Links to iHOP

6872

Sequence Information

Nucleotide Sequence

>6872 : length: 8507
GAGGAAGGAGGTGCGGGGAGGAAAGGAGAGGGTGCTCAGGCAGCGAGAACAGGGCGCAGC
TAACGCCGGGGAGGAGGATCCCGTCCTCATGGGTGCGGGAGCAACGTGGCGTGGGAGTGA
TCGTTCTGGGGGAGAGTGGGCAGAAGAGAGCGCGAGGCGAGCCCGGGGCCAGGGGCGCAG
GGAATAGTGGCTTTGGAGCTAGCGCTCTGCCGACCAGACAGTAGGACACATGCTGGTTTC
GCCTACTGAGATGGCTTCCCACCCGTAACCTGCTTGGAGATTCTTGACACTGCCTGCCCC
TCTGACATCGCTGCCCTGAGATGGCTCTATAGAGCCAGAGGACTGGACAGGACCTGCCTC
CCGCTCGTTTGGTTCCGGCCTCAGGCTTAGGACAATGGGGTGTTCCTAGCACCCGAGCGG
GCCTCCTGGTCACAGTGCGCCTTTTAGGTGGCTCTCCCAGCGTCTTCACTGACTTTCGTG
AAATAGTGTCCTGCGCCCTAGTGAAACTACCCTGCCTTCACTTAGGCCCGTTTTCTTGAG
GAGTGAAGCTGTCGGCCGCTGTGGCCCCTCCTGTGCCGCAGGCGCATGCGAAACAGGGAC
CGAACGAGCCCCGCCTCGACGCCTCCAATCCCACTGATCCCCCTGCCTCGGCCCTCGTTC
CGAGAACGACCGTTCCATTCATTCAGTCTTGGCAGTAGTTATTTGATTCGTCTTCTCTTG
TAGTATACTTTAAAGTGTGGGCGATGCAGTTGGCTGTGGTGCTTTAATAAAGATCTGATC
GATGCGGAGTTTGGTAGATGTATATTACAGTTCTCGAACGTGTTGCTTGTTTTGGCACAC
TGCACAGTCATTTTTCATGTGGATTTGTGACTTTGTCGTGGACCAGGGAAATAAGTCCTG
TGGTGTGGGAGTCGTAGGTTTAGTTGTTATCTTCGACTCGTGCTGTCCCTTTTTCAGGAA
TGTAAGAAGCACTTGGCAGGCTTGGGGGCTTTGGGGCTGGGCAGCCTGATCACTGAACTC
ACGGCAAATGAAGAATTGACCGGGACTGACGGTGCCTTGGGTGGGTTAGGAGTACAGAAG
ATGCTGTGGACTATTCAGACATCAATGAGGTGGCAGAAGATGAAAGCCGAAGATACCAGC
AGACGATGGGGAGCTTGCAGCCCCTTTGCCACTCAGATTATGATGAAGATGACTATGATG
CTGATTGTGAAGACATTGATTGCAAGTTGATGCCTCCTCCACCTCCACCCCCGGGACCAA
TGAAGAAGGATAAGGACCAGGATTCTATTACTGGTGTGTCTGAAAATGGAGAAGGCATCA
TCTTGCCCTCCATCATTGCCCCTTCCTCTTTGGCCTCAGAGAAAGTGGACTTCAGTAGTT
CCTCTGACTCAGAATCTGAGATGGGACCTCAGGAAGCAACACAGGCAGAATCTGAAGATG
GAAAGCTGACCCTTCCATTGGCTGGGATTATGCAGCATGATGCCACCAAGCTGTTGCCAA
GTGTCACAGAACTTTTTCCAGAATTTCGACCTGGAAAGGTGTTACGTTTTCTACGTCTTT
TTGGACCAGGGAAGAATGTCCCATCTGTTTGGCGGAGTGCTCGGAGAAAGAGGAAGAAGA
AGCACCGTGAGCTGATACAGGAAGAGCAGATCCAGGAGGTGGAGTGCTCAGTAGAATCAG
AAGTCAGCCAGAAGTCTTTGTGGAACTACGACTACGCTCCACCACCACCTCCAGAGCAGT
GTCTCTCTGATGATGAAATCACGATGATGGCTCCTGTGGAGTCCAAATTTTCCCAATCAA
CTGGAGATATAGATAAAGTGACAGATACCAAACCAAGAGTGGCTGAGTGGCGTTATGGGC
CTGCCCGACTGTGGTATGATATGCTGGGTGTCCCTGAAGATGGCAGTGGGTTTGACTATG
GCTTCAAACTGAGAAAGACAGAACATGAACCTGTGATAAAATCTAGAATGATAGAGGAAT
TTAGGAAACTTGAGGAAAACAATGGCACTGATCTTCTGGCTGATGAAAACTTCCTGATGG
TGACACAGCTGCATTGGGAGGATGATATCATCTGGGATGGGGAGGATGTCAAACACAAAG
GGACAAAACCTCAGCGTGCAAGCCTGGCAGGCTGGCTTCCTTCTAGCATGACTAGGAATG
CGATGGCTTACAATGTTCAGCAAGGTTTTGCAGCCACTCTTGATGATGACAAACCTTGGT
ACTCCATTTTTCCCATTGACAATGAGGATCTGGTATATGGACGCTGGGAGGACAATATCA
TTTGGGATGCTCAGGCCATGCCCCGGCTGTTGGAACCTCCTGTTTTGACACTTGATCCCA
ATGATGAGAACCTCATTTTGGAAATTCCTGATGAGAAGGAAGAGGCCACCTCTAACTCCC
CCTCCAAGGAGAGTAAGAAGGAATCATCTCTGAAGAAGAGTCGAATTCTCTTAGGGAAAA
CAGGAGTCATCAAGGAGGAACCACAGCAGAACATGTCTCAGCCAGAAGTGAAAGATCCAT
GGAATCTCTCCAATGATGAGTATTATTATCCCAAGCAACAGGGTCTTCGAGGCACCTTTG
GAGGGAATATTATCCAGCATTCAATTCCTGCTGTGGAATTACGGCAGCCCTTCTTTCCCA
CCCACATGGGGCCCATCAAACTCCGGCAGTTCCATCGCCCACCTCTGAAAAAGTACTCAT
TTGGTGCACTTTCTCAGCCAGGTCCCCACTCAGTCCAACCTTTGCTAAAGCACATCAAAA
AAAAGGCCAAGATGAGAGAACAAGAGAGGCAAGCTTCAGGTGGTGGAGAGATGTTTTTTA
TGCGCACACCTCAGGACCTCACAGGCAAAGATGGTGATCTTATTCTTGCAGAATATAGTG
AGGAAAATGGACCCTTAATGATGCAGGTTGGCATGGCAACCAAGATAAAGAACTATTATA
AACGGAAACCTGGAAAAGATCCTGGAGCACCAGATTGTAAATATGGGGAAACTGTTTACT
GCCATACATCTCCTTTCCTGGGTTCTCTCCATCCTGGCCAATTGCTGCAAGCATTTGAGA
ACAACCTTTTTCGTGCTCCAATTTATCTTCATAAGATGCCAGAAACTGATTTCTTGATCA
TTCGGACAAGACAGGGTTACTATATTCGGGAATTAGTGGATATTTTTGTGGTTGGCCAGC
AGTGTCCCTTGTTTGAAGTTCCTGGGCCTAACTCCAAAAGGGCCAATACGCATATTCGAG
ACTTTCTACAGGTTTTTATTTACCGCCTTTTCTGGAAAAGTAAAGATCGGCCACGGAGGA
TACGAATGGAAGATATAAAAAAAGCCTTTCCTTCCCATTCAGAAAGCAGCATCCGGAAGA
GGCTAAAGCTCTGCGCTGACTTCAAACGCACAGGGATGGACTCAAACTGGTGGGTGCTTA
AGTCTGATTTTCGTTTACCAACGGAAGAAGAGATCAGAGCTATGGTGTCACCAGAGCAGT
GCTGTGCTTATTATAGCATGATAGCTGCAGAGCAACGACTGAAGGATGCTGGCTATGGTG
AGAAATCCTTTTTTGCTCCAGAAGAAGAAAATGAGGAAGATTTCCAGATGAAGATTGATG
ATGAAGTTCGCACTGCCCCTTGGAACACCACAAGGGCCTTCATTGCTGCCATGAAGGGCA
AGTGTCTGCTAGAGGTGACTGGGGTGGCAGATCCCACGGGGTGTGGTGAAGGATTCTCCT
ATGTGAAGATTCCAAACAAACCAACACAGCAGAAGGATGATAAAGAACCGCAGCCAGTGA
AGAAGACAGTGACAGGAACAGATGCAGACCTTCGTCGCCTTTCCCTGAAAAATGCCAAGC
AACTTCTACGTAAATTTGGTGTGCCTGAGGAAGAGATTAAAAAGTTGTCCCGCTGGGAAG
TGATTGATGTGGTGCGCACAATGTCAACAGAACAGGCTCGTTCTGGAGAGGGGCCCATGA
GTAAATTTGCCCGTGGATCAAGGTTTTCTGTGGCTGAGCATCAAGAGCGTTACAAAGAGG
AATGTCAGCGCATCTTTGACCTACAGAACAAGGTTCTGTCATCAACTGAAGTCTTATCAA
CTGACACAGACAGCAGCTCAGCTGAAGATAGTGACTTTGAAGAAATGGGAAAGAACATTG
AGAACATGTTGCAGAACAAGAAAACCAGCTCTCAGCTTTCACGTGAACGGGAGGAACAGG
AGCGGAAGGAACTACAGCGAATGCTACTGGCAGCAGGCTCAGCAGCATCCGGAAACAATC
ACAGAGATGATGACACAGCTTCCGTGACTAGCCTTAACTCTTCTGCCACTGGACGCTGTC
TCAAGATTTATCGCACGTTTCGAGATGAAGAGGGGAAAGAGTATGTTCGCTGTGAGACAG
TCCGAAAACCAGCTGTCATTGATGCCTATGTGCGCATACGGACTACAAAAGATGAGGAAT
TCATTCGAAAATTTGCCCTTTTTGATGAACAACATCGGGAAGAGATGCGAAAAGAACGGC
GGAGGATTCAAGAGCAACTGAGGCGGCTTAAGAGGAACCAGGAAAAGGAGAAGCTTAAGG
GTCCTCCTGAGAAGAAGCCCAAGAAAATGAAGGAGCGTCCTGACCTAAAACTGAAATGTG
GGGCATGTGGTGCCATTGGACACATGAGGACTAACAAATTCTGCCCCCTCTATTATCAAA
CAAATGCGCCACCTTCCAACCCTGTTGCCATGACAGAAGAACAGGAGGAGGAGTTGGAAA
AGACAGTCATTCATAATGATAATGAAGAACTTATCAAGGTTGAAGGGACCAAAATTGTCT
TGGGGAAACAGCTAATTGAGAGTGCGGATGAGGTTCGCAGAAAATCTCTGGTTCTCAAGT
TTCCTAAACAGCAGCTTCCTCCAAAGAAGAAACGGCGAGTTGGAACCACTGTTCACTGTG
ACTATTTGAATAGACCTCATAAGTCCATCCACCGGCGCCGCACAGACCCTATGGTGACGC
TGTCGTCCATCTTGGAGTCTATCATCAATGACATGAGAGATCTTCCAAATACATACCCTT
TCCACACTCCAGTCAATGCAAAGGTTGTAAAGGACTACTACAAAATCATCACTCGGCCAA
TGGACCTACAAACACTCCGCGAAAACGTGCGTAAACGCCTCTACCCATCTCGGGAAGAGT
TCAGAGAGCATCTGGAGCTAATTGTGAAAAATAGTGCAACCTACAATGGGCCAAAACACT
CATTGACTCAGATCTCTCAATCCATGCTGGATCTCTGTGATGAAAAACTCAAAGAGAAAG
AAGACAAATTAGCTCGCTTAGAGAAAGCTATCAACCCCTTGCTGGATGATGATGACCAAG
TGGCGTTTTCTTTCATTCTGGACAACATTGTCACCCAGAAAATGATGGCAGTTCCAGATT
CTTGGCCATTTCATCACCCAGTTAATAAGAAATTTGTTCCAGATTATTACAAAGTGATTG
TCAATCCAATGGATTTAGAGACCATACGTAAGAACATCTCCAAGCACAAGTATCAGAGTC
GGGAGAGCTTTCTGGATGATGTAAACCTTATTCTGGCCAACAGTGTTAAGTATAATGGAC
CTGAGAGTCAGTATACTAAGACTGCCCAGGAGATTGTGAACGTCTGTTACCAGACATTGA
CTGAGTATGATGAACATTTGACTCAACTTGAGAAGGATATTTGTACTGCTAAAGAAGCAG
CTTTGGAGGAAGCAGAATTAGAAAGCCTGGACCCAATGACCCCAGGGCCCTACACGCCTC
AGCCTCCTGATTTGTATGATACCAACACATCCCTCAGTATGTCTCGAGATGCCTCTGTAT
TTCAAGATGAGAGCAATATGTCTGTCTTGGATATTCCCAGTGCCACTCCAGAAAAGCAGG
TAACACAGATGCGCCAGGGCCGAGGTAGGCTGGGCGAGGAAGACTCTGATGTAGATATTG
AAGGGTATGATGATGAGGAGGAGGATGGGAAACCTAAGACTCCAGCCCCAGAAGGTGAAG
ATGGAGATGGTGATCTTGCAGATGAAGAGGAAGGAACTGTACAACAGCCTCAAGCCAGTG
TCCTGTATGAGGATTTGCTTATGTCTGAAGGAGAAGATGATGAGGAAGATGCTGGGAGTG
ATGAAGAAGGAGACAATCCTTTCTCTGCTATCCAGCTGAGTGAAAGTGGAAGTGACTCTG
ATGTGGGATCTGGTGGAATAAGACCCAAACAACCCCGCATGCTTCAGGAGAACACAAGGA
TGGACATGGAAAATGAAGAAAGCATGATGTCCTATGAGGGAGACGGTGGGGAGGCTTCCC
ATGGTTTGGAGGATAGCAACATCAGTTATGGGAGCTATGAGGAGCCTGATCCCAAGTCGA
ACACCCAAGACACAAGCTTCAGCAGCATCGGTGGGTATGAGGTATCAGAGGAGGAAGAAG
ATGAGGAGGAGGAAGAGCAGCGCTCTGGGCCGAGCGTACTAAGCCAGGTCCACCTGTCAG
AGGACGAGGAGGACAGTGAGGATTTCCACTCCATTGCTGGGGACAGTGACTTGGACTCTG
ATGAATGAGGCTTCCTTTGGGCCTCCTTGGTCAGCCTTCCCTGTTCTCCAGCCTAGGTGG
TTCACCTTTCCCCAATTTGTTCATATTTGTACAGTATCTGATCCTGAAATCATGAAATTA
ACTAACACCTTAGCCTTTTTAAAAGTAGTAAGTAAATGATAATAAATCACCTCTCCTAAT
CTTCCTGGGGCAATGTCACCCTTTGATTTAAAACAAAGCAACCCCCTTTCCCCTACCACT
ACGGAAAAGAGCAAGCTCATTTTTCCGTGTCCTCCTTTATTTAACTCCATTTATTGCTTT
TGGTATAATTTTTCCCTGGGGAAGGAGGGGAAATTATGAAAGAACTAGTAACTTTATGTC
CTCTTGATGTATTAGGAAATTTCCGGCCAGGCGTGGTGGCTCACACCTGTAATCTCAGCA
CTCTGGGAGGCCGAGGCGGGCAGATCACCTGAGGTCAGAAGTTCGAGACCAGCTTGGCCA
ACATGGCGAAACCGCATCTCTACTAAAAATACAAAAATTAGCCAGGTGTGGTGGCGTATG
CCTGTTAATCCTAGCTACTCGGGAGGCTGAGGCAGGAGAATTACTTGAACCCGGGAGGCA
GAGGTTGCAGTGAGTGGAGGTCACGCCACTGCACTCCAGCCTGGGCGAAAGAGTGAGATT
CAGTCTCAAAAAAAAAAAAATTTCCAAGCATGGTATCATCTCACTTTTCTAATTTACAGG
CTGGAGCAGATGAGAGCCCTCCTGCTGGGACAGAGAATTGGGTTCTAGTGGACTCTGTGC
TACACTTAAACCTGTGAGACAAACCGCCCATTATTTTATTATTTAATTATGCAATGCCTA
GTTCCTAAATGGATTGGAGGCAAATTACCGTAAATTTTGAAACAGCCTATATGTCAGAAA
TGATAATGTTGCCACCTAAATGTTTTCTGTCCCCCCCACCCTCCCCAGGGGAAATGGTAG
GAAAATGGTAAGTTTCTTAGGGCAAAGACTGTGTCTTCTGTTTCTTTTCATGCTTAGGAT
ATGGTTCTGTGCATAGTAGGTACTCAGTAAATGTTCCTAGAATCATAAAATCCTCAACAG
ATATGTTACTGAGCATCTGCTTTTCATGATAAGCACTCTATCAGATCCTTGGGATGCAAA
GGTAAATAAGACAAATCCCTTTTACCCAAAGAGCTCACCATCAAGTTGGGGGAGGGAAAG
TGGAATTCAAAACATGTTAATAAATCATCATAGTACTGTGAGATAAGTGCAATTAAGAAG
CTAGTTATAAAGTATAGGGGAAATAGAGGAGTAATCATGTCTGAAAAGTCAGGAAAGTCT
TCCTAGAGGTAATTTTTAAGCTGATTGTTTTAGAATTAGTAGAAGCTTGCCAGATGGAAA
AGTCCAGGCAAAGTGTAACATGAATGGGAAAGGCCACAGTCTAGAAATGGCAGAGTGTGT
TCCTAGTTTGTTTGTTTGTTTGTTTGTACCTGCCTTGTTCCAGGAAGGATTTAATGTGGT
TTATATTCCAGTCCTTTAATGCTGGAAGGGCTGAGATGAGACTGAAAGATGGGCAGGAAG
TATATCATCACAAGCTTTGTGTTTGATGTTAATGTGTATGATTTTTATATTATGGGAAAT
AAGCTCTTAGAGGAGTGATATAATCAGGTTTGTGTTTTAGAAATCTGTGTAATGAATGAA
TGAAGAAAGAAATTGAAGAATCATGTAACATATGTGATCGCATTTTTGTAAAAGAACCAT
GTGTGTTTATATGTGTTTATATATATACTTGTGTATGCAAAGGTAAAAGTCTGAAAGGAT
ATATGCTAACTGTTCACAATGATAACCCCCCAGGAATGGGATTGGAGGGGAGGGGGCTTC
TGTGTTTGTTATGTATGCTGGGTGGGATATTGTGCTTTTATTTCTATATTGTTTGAATTT
TTTTACAGTATGTATTATTTTTGTAATAAAAATTTTAAAAAATTCCA

Protein Sequence

>6872 : length: 1927
MGPGCDLLLRTAATITAAAIMSDTDSDEDSAGGGPFSLAGFLFGNINGAGQLEGESVLDD
ECKKHLAGLGALGLGSLITELTANEELTGTDGALVNDEGWVRSTEDAVDYSDINEVAEDE
SRRYQQTMGSLQPLCHSDYDEDDYDADCEDIDCKLMPPPPPPPGPMKKDKDQDSITGVSE
NGEGIILPSIIAPSSLASEKVDFSSSSDSESEMGPQEATQAESEDGKLTLPLAGIMQHDA
TKLLPSVTELFPEFRPGKVLRFLRLFGPGKNVPSVWRSARRKRKKKHRELIQEEQIQEVE
CSVESEVSQKSLWNYDYAPPPPPEQCLSDDEITMMAPVESKFSQSTGDIDKVTDTKPRVA
EWRYGPARLWYDMLGVPEDGSGFDYGFKLRKTEHEPVIKSRMIEEFRKLEENNGTDLLAD
ENFLMVTQLHWEDDIIWDGEDVKHKGTKPQRASLAGWLPSSMTRNAMAYNVQQGFAATLD
DDKPWYSIFPIDNEDLVYGRWEDNIIWDAQAMPRLLEPPVLTLDPNDENLILEIPDEKEE
ATSNSPSKESKKESSLKKSRILLGKTGVIKEEPQQNMSQPEVKDPWNLSNDEYYYPKQQG
LRGTFGGNIIQHSIPAVELRQPFFPTHMGPIKLRQFHRPPLKKYSFGALSQPGPHSVQPL
LKHIKKKAKMREQERQASGGGEMFFMRTPQDLTGKDGDLILAEYSEENGPLMMQVGMATK
IKNYYKRKPGKDPGAPDCKYGETVYCHTSPFLGSLHPGQLLQAFENNLFRAPIYLHKMPE
TDFLIIRTRQGYYIRELVDIFVVGQQCPLFEVPGPNSKRANTHIRDFLQVFIYRLFWKSK
DRPRRIRMEDIKKAFPSHSESSIRKRLKLCADFKRTGMDSNWWVLKSDFRLPTEEEIRAM
VSPEQCCAYYSMIAAEQRLKDAGYGEKSFFAPEEENEEDFQMKIDDEVRTAPWNTTRAFI
AAMKGKCLLEVTGVADPTGCGEGFSYVKIPNKPTQQKDDKEPQPVKKTVTGTDADLRRLS
LKNAKQLLRKFGVPEEEIKKLSRWEVIDVVRTMSTEQARSGEGPMSKFARGSRFSVAEHQ
ERYKEECQRIFDLQNKVLSSTEVLSTDTDSSSAEDSDFEEMGKNIENMLQNKKTSSQLSR
EREEQERKELQRMLLAAGSAASGNNHRDDDTASVTSLNSSATGRCLKIYRTFRDEEGKEY
VRCETVRKPAVIDAYVRIRTTKDEEFIRKFALFDEQHREEMRKERRRIQEQLRRLKRNQE
KEKLKGPPEKKPKKMKERPDLKLKCGACGAIGHMRTNKFCPLYYQTNAPPSNPVAMTEEQ
EEELEKTVIHNDNEELIKVEGTKIVLGKQLIESADEVRRKSLVLKFPKQQLPPKKKRRVG
TTVHCDYLNRPHKSIHRRRTDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYK
IITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDE
KLKEKEDKLARLEKAINPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPD
YYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNV
CYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLDPMTPGPYTPQPPDLYDTNTSLSMS
RDASVFQDESNMSVLDIPSATPEKQVTQMRQGRGRLGEEDSDVDIEGYDDEEEDGKPKTP
APEGEDGDGDLADEEEGTVQQPQASVLYEDLLMSEGEDDEEDAGSDEEGDNPFSAIQLSE
SGSDSDVGSGGIRPKQPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEE
PDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGD
SDLDSDE