ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6863

Name

TAC1

Synonym

Hs.2563|NK2|NKNA|NPK|TAC2;tachykinin, precursor 1;TAC1;tachykinin, precursor 1

Definition

PPT|neurokinin 1|neurokinin 2|neurokinin A|neurokinin alpha|neuromedin L|neuropeptide K|neuropeptide gamma|preprotachykinin|protachykinin-1|substance K|substance P|tachykinin 2|tachykinin, precursor 1 (substance K, substance P, neurokinin 1, neurokinin 2,

Position

7q21-q22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Tachykinin receptors bind tachykinins;PID Reactome;500407

Disease

multiple sclerosis;GAD

Disease

IMMUNE;GAD

External Links

Links to cell senescence gene database

6863

Links to epithelial mesenchymal transition gene database

6863

Links to ovarian cancer gene database

6863

Links to endometrial cancer gene database

6863

Links to iHOP

6863

Sequence Information

Nucleotide Sequence

>6863 : length: 1188
CACGCAAGCGAAAGGAGAGGAGGCGGCTAATTAAATATTGAGCAGAAAGTCGCGTGGGGA
GAATGTCACGTGGGTCTGGAGGCTCAAGGAGGCTGGGATAAATACCGCAAGGCACTGAGC
AGGCGAAAGAGCGCGCTCGGACCTCCTTCCCGGCGGCAGCTACCGAGAGTGCGGAGCGAC
CAGCGTGCGCTCGGAGGAACCAGAGAAACTCAGCACCCCGCGGGACTGTCCGTCGCAAAA
TCCAACATGAAAATCCTCGTGGCCTTGGCAGTCTTTTTTCTTGTCTCCACTCAGCTGTTT
GCAGAAGAAATAGGAGCCAATGATGATCTGAATTACTGGTCCGACTGGTACGACAGCGAC
CAGATCAAGGAGGAACTGCCGGAGCCCTTTGAGCATCTTCTGCAGAGAATCGCCCGGAGA
CCCAAGCCTCAGCAGTTCTTTGGATTAATGGGCAAACGGGATGCTGATTCCTCAATTGAA
AAACAAGTGGCCCTGTTAAAGGCTCTTTATGGACATGGCCAGATCTCTCACAAAAGACAT
AAAACAGATTCCTTTGTTGGACTAATGGGCAAAAGAGCTTTAAATTCTGTGGCTTATGAA
AGGAGTGCAATGCAGAATTATGAAAGAAGACGTTAATAAACTACCTAACATTATTTATTC
AGCTTCATTTGTGTCAATGGGCAATGACAGGTAAATTAAGACATGCACTATGAGGAATAA
TTATTTATTTAATAACAATTGTTTGGGGTTGAAAATTCAAAAAGTGTTTATTTTTCATAT
TGTGCCAATATGTATTGTAAACATGTGTTTTAATTCCAATATGATGACTCCCTTAAAATA
GAAATAAGTGGTTATTTCTCAACAAAGCACAGTGTTAAATGAAATTGTAAAACCTGTCAA
TGATACAGTCCCTAAAGAAAAAAAATCATTGCTTTGAAGCAGTTGTGTCAGCTACTGCGG
AAAAGGAAGGAAACTCCTGACAGTCTTGTGCTTTTCCTATTTGTTTTCATGGTGAAAATG
TACTGAGATTTTGGTATTACACTGTATTTGTATCTCTGAAGCATGTTTCATGTTTTGTGA
CTATATAGAGATGTTTTTAAAAGTTTCAATGTGATTCTAATGTCTTCATTTCATTGTATG
ATGTGTTGTGATAGCTAACATTTTAAATAAAAGAAAAAATATCTTGAA

Protein Sequence

>6863 : length: 129
MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPK
PQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERS
AMQNYERRR