ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6857

Name

SYT1

Synonym

P65|SVP65|SYT;synaptotagmin I;SYT1;synaptotagmin I

Definition

synaptotagmin 1|synaptotagmin-1|sytI

Position

12cen-q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Effects of Botulinum toxin;PID Curated;200160

Pathway

Synaptic vesicle trafficking;PANTHER;P05734

Pathway

Acetylcholine Neurotransmitter Release Cycle;PID Reactome;500153

Pathway

Dopamine Neurotransmitter Release Cycle;PID Reactome;500151

Pathway

Serotonin Neurotransmitter Release Cycle;PID Reactome;500149

Pathway

Synaptic Transmission;Reactome;REACT:13685

Pathway

Neurotransmitter Release Cycle;PID Reactome;500147

Pathway

Glutamate Neurotransmitter Release Cycle;PID Reactome;500150

Pathway

Norepinephrine Neurotransmitter Release Cycle;PID Reactome;500148

Pathway

Botulinum neurotoxicity;Reactome;REACT:11184

Disease

HEMATOLOGICAL;GAD

Disease

serum creatinine;GAD

External Links

Links to cell senescence gene database

6857

Links to epithelial mesenchymal transition gene database

6857

Links to ovarian cancer gene database

6857

Links to endometrial cancer gene database

6857

Links to iHOP

6857

Sequence Information

Nucleotide Sequence

>6857 : length: 4841
ATCTCGGCTCCACCGCACCCTTCGCGGGAAGTCCCCAGGCTTCCAGCAAAGCTCAGCTTA
TCCCGCCCCCGCTTCCAACCCGGAACCCCAGAAGAACAGCATGATGAGCCTCCGGCAGCC
AGGTGGGCCACCTCCCCGCGGCTCAGTTTGAGGACACTTGTGCGGAACCCTTTCACATCC
CCACCCTACCCAGCTTTCACAACTCCGCCGGGTTAAATGGCCAAAGACAAACTTCTACCT
CTCCTGTCCCCGGTCCCAGCTTTTCAAAAACCCACAGCTGGCGAACCCACACACATCGAA
ACTCCTAGGTCGCTGTTGCAGTCTGGGCATGCTCAGTATCAGGGCTGCCCCTCCAAGAGC
GGAGGCAGCGAGAGTACGCGTGTGCCTCGCGCCGGTCCACGCGGGGAGAGCACTGGGGAC
CGAGACCCGGCACCACCTCCCGGTCCGCCCTCCAGGGAAAACGGGAAAACTAGCAAGAGC
TAGCAAGAACTAGCAAGAGCTTGAACAAACGCCTGGACTCAGATTGGAAGACTGCTCATT
TGTCTACTGCCTCATTCCTGGAAATTGCACTGGAACTGTCTGATTAAGAAAAACAGAATA
ATTCTGAAAGAAAGAAAACAAAGAAAAACATACTCCAGAATTCCTAATAGAACACTTCAC
CTGAACCTAAAATGGTGAGCGAGAGTCACCATGAGGCCCTGGCAGCCCCGCCTGTCACCA
CTGTCGCGACTGTTCTGCCAAGCAACGCCACAGAGCCAGCCAGTCCTGGAGAAGGAAAGG
AAGATGCATTTTCTAAGCTGAAGGAGAAGTTTATGAATGAGTTGCATAAAATTCCATTGC
CACCGTGGGCCTTAATTGCAATAGCCATAGTCGCAGTCCTTTTAGTCCTGACCTGCTGCT
TTTGTATCTGTAAGAAATGTTTGTTCAAAAAGAAAAACAAGAAGAAGGGAAAGGAAAAAG
GAGGGAAGAATGCCATTAACATGAAAGATGTAAAAGACTTAGGGAAGACGATGAAAGATC
AGGCCCTCAAGGATGATGATGCTGAAACTGGATTGACAGATGGAGAAGAAAAAGAAGAAC
CCAAAGAAGAGGAGAAACTGGGAAAACTTCAGTATTCACTGGATTATGATTTCCAAAATA
ACCAGCTGCTGGTAGGGATCATTCAGGCTGCCGAACTGCCCGCCTTGGACATGGGGGGCA
CATCTGATCCTTACGTGAAAGTGTTTCTGCTACCTGATAAGAAGAAGAAATTTGAGACAA
AAGTCCACCGAAAAACCCTTAATCCTGTCTTCAATGAGCAATTTACTTTCAAGGTACCAT
ACTCGGAATTGGGTGGCAAAACCCTAGTGATGGCTGTATATGATTTTGATCGTTTCTCTA
AGCATGACATCATTGGAGAATTTAAAGTCCCTATGAACACAGTGGATTTTGGCCATGTAA
CTGAGGAATGGCGTGACCTGCAAAGTGCTGAGAAGGAAGAGCAAGAGAAATTGGGTGATA
TCTGCTTCTCCCTTCGCTACGTACCTACTGCTGGTAAGCTGACTGTTGTCATTCTGGAGG
CAAAGAACCTGAAGAAGATGGATGTGGGTGGCTTATCCGATCCTTATGTGAAGATTCATC
TGATGCAGAATGGTAAGAGGCTGAAGAAGAAAAAGACAACAATTAAAAAGAACACACTTA
ACCCCTACTACAATGAGTCATTCAGCTTTGAAGTACCTTTTGAACAAATCCAGAAAGTGC
AGGTGGTGGTAACTGTTTTGGACTATGACAAGATTGGCAAGAACGATGCCATCGGCAAAG
TCTTTGTGGGCTACAACAGCACCGGCGCGGAGCTGCGACACTGGTCAGACATGCTGGCCA
ACCCCAGGCGACCTATTGCCCAGTGGCACACCCTGCAGGTAGAGGAGGAAGTTGATGCCA
TGCTGGCCGTCAAGAAGTAAAGGAAAGAAGAAGCCTTTCTGCATTTGCCCATATAGTGCT
CTTTAGCCAGTATCTGTAAATACCTCAGTAATATGGGTCCTTTCATTTTTCCAGCCATGC
ATTCCTAACACAATTCAGTGGTACTTGGAATCCTGTTTTAATTTGCACAAATTTAAATGT
AGAGAGCCCCTAAGTCCTTCATCATACCACTGCCCTCCAAATCTACTCTTCTTTTAAGCA
ATATGATGTGTAGATAGAGCATGAATGAAATTATTTATTGTATCACACTGTTGTATATAC
CAGTATGCTAAAGATTTATTTCTAGTTTGTGTATTTGTATGTTGTAAGCGTTTCCTAATC
TGTGTATATCTAGATGTTTTTAATAAGATGTTCTATTTTAAACTATGTAAATTGACTGAG
ATATAGGAGAGCTGATAATATATTATACGGTAAATATAGTATCGTCTGCATTCCAGCAAA
AATATCAACTCGTAAGGCACTAGTACAGTTAAACTGACATCTTAAAGGACAACTTAAACC
TGAGCTTTCTATTGAATCATTTGAGTACCAAGATAAACTTACACCACATACTTGGTGGGT
GAATCCAATTTTGTAGAATTCCTACACAGGCAAAATAGCATGATCTGAGCAGCAGCATCC
AGGCTGACCTCAAGGAAGCATAGCCACAAAACAGAATAGCACCTGTCTGTACATATTTAC
AAAGCTAAAATAATGGCTTCACTCTTATATTTGAGGAAGCAACTGAACAGGAGTCAATGA
TTTCATATTACTGCATATAGAATAACAACAAGGTGTTCCGTGTGTGTGTGTGTGTGTGTG
TGTGTGTGTGTGTGCACATTTGTTTGGGGATGGGGGAGAAGAAGCTAAGGGGAGAAGTCA
ACATTTATGAAATATTGCCTGACTATTTAAAAAGAAAAAAGTAGCTCTCCATTATCACCT
TTATACAAAATGTACATCCTGTGAATTCTGTTCCAGATTTCACACCTACAATAATTCCAA
AAGGTTTGCACATTAGAGTTTGTAACAAAATATTTTATTATATAAAACCAGGTTAGAAGG
AATGCAGGATATTTTTAACACAACAATCTGTGCTTATTACACAAAATTACTTTGTGGTAA
ACAGACAGTATTGTAATCCCATCAAAAGATGAAAGAAAAACAAAAACAAAAACCAACAAC
AATTAGCCATAGTTCTGAATGCACTTCAATTAAGCCAAAACAGACAGCTAGTGATCTTTT
TATATGCTCTTTTTACTTAAGTTTTAATTTGTCCTTTAAAAAAAGGTGAAACAAACCAAG
AACAAGTTCTAGAAAACTGAAGCAACCTCTTATGTATACTAGATGCTTGATTTAGGAGGA
GTTTTTAAACGTTTTCAATGTTATTATGTAGTAAATGACACTATTATGAAGCTACTAGTC
ATTCCATAAGAGTCTTAAAGGACTGCTCTGTGTAACACTGTGACTGCCGTGTGTGCTTAG
ACCCGTAGTTTCCTCAGTGGATAGCACTCAATTTATTCCGTAGTGATATTGTAACAATAC
TGCCATTCCCTTCTACTGCACTGCCCAAGGTGTGTGTAGCACAAACAGTTCTCATTACAA
AGGACCAATTCAGAACTGAAAAGCTATGCATAGGACAAGGAAGATACATAGAATGGGGTG
GAACACAGCATTTTGTCAAGCACTGTGCAATATTCCATATTTTTCCCCACTATGGTAGAC
AACCATTTCGTGGAAGGGCAGCCTATTATCCCACACTGCATCTAGCCTTTTGTCCCATTC
ACTTCTGTGATCCATTTTAATTTCCAGGCCACAAGACAGTAGTGATGCTCTGAAATGAAA
GTTTGTCTTCACAAATATCAAAACAAAATGGAGGAAAACTAAGCATTGGCCTCATGTTCA
GTCTTCAGGATATCACACCACGTCTTTTCAAAAACTAAAGAGAATTCAAAAAGGGCTGAT
GGTAGGCTTTGAACATGGGGTTGGCTGTTTCCCAGTAAAACTGGAATTCCTGTCGTTACT
GTTTCCTTATCAAAGAAGGGGCAAGCTCTTTTGCCTTTTAGGCCAGACATAGCAAACGCT
TTATAATTGGCATAGACATAAAGGATAAAAGGAAAATAACCGTCTGCCGATGGTCCGTAC
TTCTTAAAAAACATAGGTAATAGAAAATATACACAAGTCAGAATGTGAAATTAAATAATG
GTTTGAACAGAAAATTCAAACAAGACTCTTTCCAATTTAAAGGGCCAAACCCTACCAAAG
AGAGGGAGTTGACTGGCTTTTAAAAAGTATTTAAATACCACAAATGACATTTAATTTCAC
TGTATTCAGCTTTAAGTTGTTCACAATGAAACCACACTTTCAAACAAGCAGGTTCAAGCT
GCTGAATAGACATTATTTCTTGCATTAAAATACCACTAATGCATTCTCTTGCAACACTGC
CAGACATGGGATTGTCACCATAGAATTAGTTGGTACTATGCCATCTTTCACTCTTTCACA
AGTCAGTGATGGAACCTGCTTTATGACCAAGATTCATCCTCAAATAAGCCACATGTACCC
TTCTGACAAAGCTGTGTAAAGTATTAGAATCTGATGCTCTAGAAAGATCCTAGTTGCCTT
TGTGTATATTTACTGCCTGCTTGAGTGTTTCTATGTGTGGGTTTTCCCTGTATCTTGTAG
AAATGTTGGGGTGTTTTCCTCTGCCATATGGCTCGTGGCCTGCGAGCCAACTATTTCAGC
TGTATTTTACCTTCATTTTTGATGAGGTGATTTAAATTTTGTTTCACTTTGTGTAGTGAA
TTCCACAGTAGTTTTCTGATTGTTGTTAAAAATGACTTAACATATTACACAGATATTCAA
TAAAAATGTTTTATTTCCTGTTGAAAAAAAAAAAAAAAAAA

Protein Sequence

>6857 : length: 422
MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWA
LIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALK
DDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDP
YVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDI
IGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL
KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVV
TVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAV
KK