ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6850

Name

SYK

Synonym

p72-Syk;spleen tyrosine kinase;SYK;spleen tyrosine kinase

Definition

tyrosine-protein kinase SYK

Position

9q22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

B cell receptor signaling pathway;KEGG PATHWAY;hsa04662

Pathway

ras-independent pathway in nk cell-mediated cytotoxicity;PID BioCarta;100095

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Alpha-synuclein signaling;PID Curated;200187

Pathway

GPVI-mediated activation cascade;PID Reactome;500294

Pathway

Integrin cell surface interactions;Reactome;REACT:13552

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

Atypical NF-kappaB pathway;PID Curated;200017

Pathway

B cell activation;PANTHER;P00010

Pathway

Fc-epsilon receptor I signaling in mast cells;PID Curated;200003

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

bcr signaling pathway;PID BioCarta;100227

Pathway

il 2 signaling pathway;PID BioCarta;100130

Pathway

fc epsilon receptor i signaling in mast cells;PID BioCarta;100165

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

Hemostasis;Reactome;REACT:604

Pathway

FAS (CD95) signaling pathway;PID Curated;200067

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Pathway

GMCSF-mediated signaling events;PID Curated;200015

External Links

Links to cell senescence gene database

6850

Links to epithelial mesenchymal transition gene database

6850

Links to ovarian cancer gene database

6850

Links to endometrial cancer gene database

6850

Links to iHOP

6850

Sequence Information

Nucleotide Sequence

>6850 : length: 5129
TCCGGGCTCATGGGCGCGGTCAGCAGGGCGGGCCAGGGCGGCGGGGCGCGACACTGGGAG
GAAGTGCGGGCCGCCTGCCCGGGCGCGTTAAGGAAGTTGCCCAAAATGAGGAAGAGCCGC
GGGCCCGGCGGCTGAGGCCACCCCGGCGGCGGCTGGAGAGCGAGGAGGAGCGGGTGGCCC
CGCGCTGCGCCCGCCCTCGCCTCACCTGGCGCAGGTGGACACCTGCGCAGGTGTGTGCCC
TCCGGCCCCTGAAGCATGGCCAGCAGCGGCATGGCTGACAGCGCCAACCACCTGCCCTTC
TTTTTCGGCAACATCACCCGGGAGGAGGCAGAAGATTACCTGGTCCAGGGGGGCATGAGT
GATGGGCTTTATTTGCTGCGCCAGAGCCGCAACTACCTGGGTGGCTTCGCCCTGTCCGTG
GCCCACGGGAGGAAGGCACACCACTACACCATCGAGCGGGAGCTGAATGGCACCTACGCC
ATCGCCGGTGGCAGGACCCATGCCAGCCCCGCCGACCTCTGCCACTACCACTCCCAGGAG
TCTGATGGCCTGGTCTGCCTCCTCAAGAAGCCCTTCAACCGGCCCCAAGGGGTGCAGCCC
AAGACTGGGCCCTTTGAGGATTTGAAGGAAAACCTCATCAGGGAATATGTGAAGCAGACA
TGGAACCTGCAGGGTCAGGCTCTGGAGCAGGCCATCATCAGTCAGAAGCCTCAGCTGGAG
AAGCTGATCGCTACCACAGCCCATGAAAAAATGCCTTGGTTCCATGGAAAAATCTCTCGG
GAAGAATCTGAGCAAATTGTCCTGATAGGATCAAAGACAAATGGAAAGTTCCTGATCCGA
GCCAGAGACAACAACGGCTCCTACGCCCTGTGCCTGCTGCACGAAGGGAAGGTGCTGCAC
TATCGCATCGACAAAGACAAGACAGGGAAGCTCTCCATCCCCGAGGGAAAGAAGTTCGAC
ACGCTCTGGCAGCTAGTCGAGCATTATTCTTATAAAGCAGATGGTTTGTTAAGAGTTCTT
ACTGTCCCATGTCAAAAAATCGGCACACAGGGAAATGTTAATTTTGGAGGCCGTCCACAA
CTTCCAGGTTCCCATCCTGCGACTTGGTCAGCGGGTGGAATAATCTCAAGAATCAAATCA
TACTCCTTCCCAAAGCCTGGCCACAGAAAGTCCTCCCCTGCCCAAGGGAACCGGCAAGAG
AGTACTGTGTCATTCAATCCGTATGAGCCAGAACTTGCACCCTGGGCTGCAGACAAAGGC
CCCCAGAGAGAAGCCCTACCCATGGACACAGAGGTGTACGAGAGCCCCTACGCGGACCCC
GAGGAGATCAGGCCCAAGGAGGTTTACCTGGACCGAAAGCTGCTGACGCTGGAAGACAAA
GAACTGGGCTCTGGTAATTTTGGAACTGTGAAAAAGGGCTACTACCAAATGAAAAAAGTT
GTGAAAACCGTGGCTGTGAAAATACTGAAAAACGAGGCCAATGACCCCGCTCTTAAAGAT
GAGTTATTAGCAGAAGCAAATGTCATGCAGCAGCTGGACAACCCGTACATCGTGCGGATG
ATCGGGATATGCGAGGCCGAGTCCTGGATGCTGGTTATGGAGATGGCAGAACTTGGTCCC
CTCAATAAGTATTTGCAGCAGAACAGACATGTCAAGGATAAGAACATCATAGAACTGGTT
CATCAGGTTTCCATGGGCATGAAGTACTTGGAGGAGAGCAATTTTGTGCACAGAGATCTG
GCTGCAAGAAATGTGTTGCTAGTTACCCAACATTACGCCAAGATCAGTGATTTCGGACTT
TCCAAAGCACTGCGTGCTGATGAAAACTACTACAAGGCCCAGACCCATGGAAAGTGGCCT
GTCAAGTGGTACGCTCCGGAATGCATCAACTACTACAAGTTCTCCAGCAAAAGCGATGTC
TGGAGCTTTGGAGTGTTGATGTGGGAAGCATTCTCCTATGGGCAGAAGCCATATCGAGGG
ATGAAAGGAAGTGAAGTCACCGCTATGTTAGAGAAAGGAGAGCGGATGGGGTGCCCTGCA
GGGTGTCCAAGAGAGATGTACGATCTCATGAATCTGTGCTGGACATACGATGTGGAAAAC
AGGCCCGGATTCGCAGCAGTGGAACTGCGGCTGCGCAATTACTACTATGACGTGGTGAAC
TAACCGCTCCCGCACCTGTCGGTGGCTGCCTTTGATCACAGGAGCAATCACAGGAAAATG
TATCCAGAGGAATTGATTGTCAGCCACCTCCCTCTGCCAGTCGGGAGAGCCAGGCTTGGA
TGGAACATGCCCACAACTTGTCACCCAAAGCCTGTCCCAGGACTCACCCTCCACAAAGCA
AAGGCAGTCCCGGGAGAAAAGACGGATGGCAGGATCCAAGGGGCTAGCTGGATTTGTTTG
TTTTCTTGTCTGTGTGATTTTCATACAGGTTATTTTTACGATCTGTTTCCAAATCCCTTT
CATGTCTTTCCACTTCTCTGGGTCCCGGGGTGCATTTGTTACTCATCGGGCCCAGGGACA
TTGCAGAGTGGCCTAGAGCACTCTCACCCCAAGCGGCCTTTTCCAAATGCCCAAGGATGC
CTTAGCATGTGACTCCTGAAGGGAAGGCAAAGGCAGAGGAATTTGGCTGCTTCTACGGCC
ATGAGACTGATCCCTGGCCACTGAAAAGCTTTCCTGACAATAAAAATGTTTTGAGGCTTT
AAAAAGAAAATCAAGTTTGACCAGTGCAGTTTCTAAGCATGTAGCCAGTTAAGGAAAGAA
AGAAAGAAAAAAAAAAAAGGCCTGGATACTGCTTTTGCTGTCTCTGTTATGAGATGGAAG
ACTTACATGTTTGTGATAAAAGGGGACCATGAGAATGAATTGGCTTGGCTTACTTTCCCC
CTGAAATCCTCTCTCCTGCAGACTGTCTTGAAGACCTGGTGACTGGTAAATAAAGCCCTG
CATGGAGGCTGCACAGCAGGGGCAAGAGGCCCATCCCCCAGCATCTCACTGAGGACAGCT
TCAGGCTGCCTTCCTCTGAACGTGGTCCACACCTTCCTCTCCTCCACAGAGAGGGTGCCG
CCAGAATCCCCTGTCGCTTTCTGTGTCTGCAATGGGGGGCAGCACAGGGATCAAAGCCAT
CTAAAGAGTTTCCAAAGAAAGTATTAATTCAGAACAAGCCAAAGACCCTGAGCCTCACCA
CAAACAGGCCTTTTGGAGTGTGAATTTGAGTTGAAGATACAAGATCGGAGAATGATTTTC
TGGTCTTAACTAATCCTCATCTTCATGTTTGATCTTTAAGAAGTCATCACCCATTGATTT
CAGTTTTGCTGTACCTCTTGAAAGTTAAAGAGACATCTCAGCACTTTAGGAGGCCGAGGC
GGGTGGATCACTTGAGGTAAGGAGTTTGAGACTAGCCTGGCCAATATGGTAAAACCCCAT
CTCTACTAAAAATACAAAAATTAGCCGGGCATGGTGGCATGTGTCTGTAGTCCCAGCTAC
TCGGGAGGCTGAGGCAGGAGAATCGCTTGAACCCAGGAAACGGAGGTCGCAGTGAGCCAA
GATCATGCCACTGCACTCCAGCTTGGGCATCACAGCGAGACTCTGTCAAAACAAACAAAC
AAAAAAACAACTTAAAGAGGTAATTTAGCCATCATTCTTATGCCAGCAGATATAAATAAA
CTTGGACCCATCTGGTCTTCAGCTAAACCTGAGACATTTTAAAGTGCATGGACAGCCATG
GACAGCAGGCCCTCCTCTAACAGGGGATGCAAGGCATGGAGAAAGACAATCAGTACCCAA
GCTCAGCCACAGAAGACAGGAGTCACTCATATAACTTGTGTTTAGAAGTTTTTGGTAGCC
ACGCACACTTTCTGAAATCACACTATCTGGTGGTTTAATCATATTTTTAAAGACAGAATC
CCTGAGTGCTGAGCAGATTCTCAAAACACATTTAGAATCCCTGAAATTAGAAAGATCAAT
GACAAAATATCTGTCAGCCAGGCCACAAACAGGTGTAAAATTATGAAAGGAGTGGTTGGA
TGTGCCAAGTTTGGTAAAGTGGTGACTGCATCTGAGAAAGAGGCTGTGAGGCTGAACTCT
TGGTGGCTTCCTTCTGTAACTTCCAGAGGGAGTCTTCAACACAGGCCCCGTGCTCGTAGG
AATACGGTAGCACCTATGTAGGAAGTGCGTGGAGTTTTCTGTCTTCTTTCTGTGTGATTT
TTGGCCTTTTTATCAGCACTTCTCCCCTCCCAGGAGCCTGGGGATGCCAAACATCCAGAA
TGTGATGGGACAAGATGGGGGCAGGGGCCTCACCTCCCTGCAGAGGTCCGGCCAGGTCTC
CTTGTCCCTGGACAATCTCCTGAGCCTCTCTGCTTGGTGGAGCAGGCACCTGTGTGCAGA
ATTCCCACTGTGGCCAGCACGAGGAAGTCTTTTCTAGTGAAAATGTGTCTTGTGGTCAGG
AATAATTATCCTTTCCCCTGTAGCCACCAAGGAGGGCAAATAGAGAAAGGTAACCTAATT
GAAGGATTGGTCATGTGAAAAGGGCTACATTTGGGAAGCTGGGAAAGGCCTCCAGGCTTC
TAGAGCAGCTAGCTTGGGCTGGATTCTCATACCCAGGCTGCCCCTTGGATTGTTCTACCC
AAGCTTTTCCCTGGGGTCTGGGCTCACTCCATAAGGTAAGGTGCCTTTTACCTTATGGTC
CTTCTTTAGCAGGTAACAAAGGAGCATCAGGGGCAGGCTGCCCTGGTGGCATCACACTGG
CTAGTGAGGCCGTGAATATCTTGTCCCCCAGCAGGGCCGACAGTTTCTATCACAGAAAAC
AGTGTGTTCAGTGGTGAAAATCGTTGCATGCATGTTTTCATCTGAGCGTGTCCTTCTCCC
ATACTCCCTATCAGCCAGCCCTGCCTGTAGCTGCTGTATGGTGATTGCACTTGGACATCA
GTCCAATGACTGCAAGTCGGCCTGGATTTTCACTTGCAGAGGCTACAGCTGCATTGTCAG
GTCTCCCAGCCCTGCAGAGAGCTCCCTCCACTGGTTAGCAGTGTGTTGTGTTTTCCATTC
ATTTCAGAAGAGCTACATTGTGTCACTGGACATTTTTAAAAACTGTGATTTTTAATAAAA
ATTTAAAATTTGCTTTGTGATGAAAAAAA

Protein Sequence

>6850 : length: 635
MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN