ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6790

Name

AURKA

Synonym

AIK|ARK1|AURA|AURORA2|BTAK|PPP1R47|STK15|STK6|STK7;aurora kinase A;AURKA;aurora kinase A

Definition

ARK-1|Aurora-A kinase|IPL1-related kinase|aurora 2|aurora-related kinase 1|aurora/IPL1-like kinase|aurora/IPL1-related kinase 1|breast tumor-amplified kinase|breast-tumor-amplified kinase|hARK1|protein phosphatase 1, regulatory subunit 47|serine/threonine

Position

20q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Aurora B signaling;PID Curated;200010

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

Pathway

role of ran in mitotic spindle regulation;PID BioCarta;100051

Pathway

Aurora A signaling;PID Curated;200166

Pathway

Signaling by Aurora kinases;PID Curated;200047

Pathway

PLK1 signaling events;PID Curated;200087

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Disease

esophageal cancer;GAD

Disease

breast cancer;GAD

Disease

overall effect;GAD

Disease

CANCER;GAD

Disease

pancreatic cancer;GAD

Disease

Colon cancer, susceptibility to;OMIM

Disease

colorectal cancer;GAD

External Links

Links to cell senescence gene database

6790

Links to epithelial mesenchymal transition gene database

6790

Links to ovarian cancer gene database

6790

Links to endometrial cancer gene database

6790

Links to iHOP

6790

Sequence Information

Nucleotide Sequence

>6790 : length: 2554
ACAAGGCAGCCTCGCTCGAGCGCAGGCCAATCGGCTTTCTAGCTAGAGGGTTTAACTCCT
ATTTAAAAAGAAGAACCTTTGAATTCTAACGGCTGAGCTCTTGGAAGACTTGGGTCCTTG
GGTCGCAGGTGGGAGCCGACGGGTGGGTAGACCGTGGGGGATATCTCAGTGGCGGACGAG
GACGGCGGGGACAAGGGGCGGCTGGTCGGAGTGGCGGAGCGTCAAGTCCCCTGTCGGTTC
CTCCGTCCCTGAGTGTCCTTGGCGCTGCCTTGTGCCCGCCCAGCGCCTTTGCATCCGCTC
CTGGGCACCGAGGCGCCCTGTAGGATACTGCTTGTTACTTATTACAGCTAGAGGGTCTCA
CTCCATTGCCCAGGCCAGAGTGCGGGGATATTTGATAAGAAACTTCAGTGAAGGCCGGGC
GCGGTGGCTCATGCCCGTAATCCCAGCATTTTCGGAGGCCGAGGCTGGAGTGCAATGGTG
TGATCTCAGCTCACTGCAACCTCTGCTTCCTGGGTTTAAGTGATTCTCCTGCCTCAGCCT
CCCGAGTAGCTGGGATTACAGGCATCATGGACCGATCTAAAGAAAACTGCATTTCAGGAC
CTGTTAAGGCTACAGCTCCAGTTGGAGGTCCAAAACGTGTTCTCGTGACTCAGCAATTTC
CTTGTCAGAATCCATTACCTGTAAATAGTGGCCAGGCTCAGCGGGTCTTGTGTCCTTCAA
ATTCTTCCCAGCGCATTCCTTTGCAAGCACAAAAGCTTGTCTCCAGTCACAAGCCGGTTC
AGAATCAGAAGCAGAAGCAATTGCAGGCAACCAGTGTACCTCATCCTGTCTCCAGGCCAC
TGAATAACACCCAAAAGAGCAAGCAGCCCCTGCCATCGGCACCTGAAAATAATCCTGAGG
AGGAACTGGCATCAAAACAGAAAAATGAAGAATCAAAAAAGAGGCAGTGGGCTTTGGAAG
ACTTTGAAATTGGTCGCCCTCTGGGTAAAGGAAAGTTTGGTAATGTTTATTTGGCAAGAG
AAAAGCAAAGCAAGTTTATTCTGGCTCTTAAAGTGTTATTTAAAGCTCAGCTGGAGAAAG
CCGGAGTGGAGCATCAGCTCAGAAGAGAAGTAGAAATACAGTCCCACCTTCGGCATCCTA
ATATTCTTAGACTGTATGGTTATTTCCATGATGCTACCAGAGTCTACCTAATTCTGGAAT
ATGCACCACTTGGAACAGTTTATAGAGAACTTCAGAAACTTTCAAAGTTTGATGAGCAGA
GAACTGCTACTTATATAACAGAATTGGCAAATGCCCTGTCTTACTGTCATTCGAAGAGAG
TTATTCATAGAGACATTAAGCCAGAGAACTTACTTCTTGGATCAGCTGGAGAGCTTAAAA
TTGCAGATTTTGGGTGGTCAGTACATGCTCCATCTTCCAGGAGGACCACTCTCTGTGGCA
CCCTGGACTACCTGCCCCCTGAAATGATTGAAGGTCGGATGCATGATGAGAAGGTGGATC
TCTGGAGCCTTGGAGTTCTTTGCTATGAATTTTTAGTTGGGAAGCCTCCTTTTGAGGCAA
ACACATACCAAGAGACCTACAAAAGAATATCACGGGTTGAATTCACATTCCCTGACTTTG
TAACAGAGGGAGCCAGGGACCTCATTTCAAGACTGTTGAAGCATAATCCCAGCCAGAGGC
CAATGCTCAGAGAAGTACTTGAACACCCCTGGATCACAGCAAATTCATCAAAACCATCAA
ATTGCCAAAACAAAGAATCAGCTAGCAAACAGTCTTAGGAATCGTGCAGGGGGAGAAATC
CTTGAGCCAGGGCTGCCATATAACCTGACAGGAACATGCTACTGAAGTTTATTTTACCAT
TGACTGCTGCCCTCAATCTAGAACGCTACACAAGAAATATTTGTTTTACTCAGCAGGTGT
GCCTTAACCTCCCTATTCAGAAAGCTCCACATCAATAAACATGACACTCTGAAGTGAAAG
TAGCCACGAGAATTGTGCTACTTATACTGGTTCATAATCTGGAGGCAAGGTTCGACTGCA
GCCGCCCCGTCAGCCTGTGCTAGGCATGGTGTCTTCACAGGAGGCAAATCCAGAGCCTGG
CTGTGGGGAAAGTGACCACTCTGCCCTGACCCCGATCAGTTAAGGAGCTGTGCAATAACC
TTCCTAGTACCTGAGTGAGTGTGTAACTTATTGGGTTGGCGAAGCCTGGTAAAGCTGTTG
GAATGAGTATGTGATTCTTTTTAAGTATGAAAATAAAGATATATGTACAGACTTGTATTT
TTTCTCTGGTGGCATTCCTTTAGGAATGCTGTGTGTCTGTCCGGCACCCCGGTAGGCCTG
ATTGGGTTTCTAGTCCTCCTTAACCACTTATCTCCCATATGAGAGTGTGAAAAATAGGAA
CACGTGCTCTACCTCCATTTAGGGATTTGCTTGGGATACAGAAGAGGCCATGTGTCTCAG
AGCTGTTAAGGGCTTATTTTTTTAAAACATTGGAGTCATAGCATGTGTGTAAACTTTAAA
TATGCAAATAAATAAGTATCTATGTCTAAAAAAA

Protein Sequence

>6790 : length: 403
MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRIPLQ
AQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKN
EESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRR
EVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITEL
ANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEM
IEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLI
SRLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS