ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6760

Name

SS18

Synonym

SSXT|SYT;synovial sarcoma translocation, chromosome 18;SS18;synovial sarcoma translocation, chromosome 18

Definition

protein SSXT|synovial sarcoma translocated to X chromosome protein|synovial sarcoma, translocated to X chromosome

Position

18q11.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

6760

Links to epithelial mesenchymal transition gene database

6760

Links to ovarian cancer gene database

6760

Links to endometrial cancer gene database

6760

Links to iHOP

6760

Sequence Information

Nucleotide Sequence

>6760 : length: 3699
AGTTTGCCGTTCACCCGGAGCGCTCGGGACTTGCCGATAGTGGTGACGGCGGCAACATGT
CTGTGGCTTTCGCGGCCCCGAGGCAGCGAGGCAAGGGGGAGATCACTCCCGCTGCGATTC
AGAAGATGTTGGATGACAATAACCATCTTATTCAGTGTATAATGGACTCTCAGAATAAAG
GAAAGACCTCAGAGTGTTCTCAGGTGAGTCCAAACTATTCCAGAGTTGCATAAATTTCAA
ACAACAAAAAAAATTAGTGTCGATCATTCATCGTAATTTAAAAGAGTTGTTTAAATCTGT
AGTTTGGAAGATAACTTTTATTCTATAAAGTGCATTCCCGTTGTCTAATAAATATTCATA
GCTTCTAGGGTCATGAATAAACCACATCTGTTAGTATGGTTTGGTCAGTGGTCCTCAGAA
AATCTCATGTCGTGCAACCATACTAATACTCAAGCAAAGGAAAACTTGAAGGCCTAGACT
GAAACAGGTATCAGCAGATGTTGCACACAAACTTGGTATACCTTGCTACAATAGCAGATT
CTAATCAAAATATGCAGTCTCTTTTACCAGCACCACCCACACAGAATATGCCTATGGGTC
CTGGAGGGATGAATCAGAGCGGCCCTCCCCCACCTCCACGCTCTCACAACATGCCTTCAG
ATGGAATGGTAGGTGGGGGTCCTCCTGCACCGCACATGCAGAACCAGATGAACGGCCAGA
TGCCTGGGCCTAACCATATGCCTATGCAGGGACCTGGACCCAATCAACTCAATATGACAA
ACAGTTCCATGAATATGCCTTCAAGTAGCCATGGATCCATGGGAGGTTACAACCATTCTG
TGCCATCATCACAGAGCATGCCAGTACAGAATCAGATGACAATGAGTCAGGGACAACCAA
TGGGAAACTATGGTCCCAGACCAAATATGAGTATGCAGCCAAACCAAGGTCCAATGATGC
ATCAGCAGCCTCCTTCTCAGCAATACAATATGCCACAGGGAGGCGGACAGCATTACCAAG
GACAGCAGCCACCTATGGGAATGATGGGTCAAGTTAACCAAGGCAATCATATGATGGGTC
AGAGACAGATTCCTCCCTATAGACCTCCTCAACAGGGCCCACCACAGCAGTACTCAGGCC
AGGAAGACTATTACGGGGACCAATACAGTCATGGTGGACAAGGTCCTCCAGAAGGCATGA
ACCAGCAATATTACCCTGATGGTCATAATGATTACGGTTATCAGCAACCGTCGTATCCTG
AACAAGGCTACGATAGGCCTTATGAGGATTCCTCACAACATTACTACGAAGGAGGAAATT
CACAGTATGGCCAACAGCAAGATGCATACCAGGGACCACCTCCACAACAGGGATATCCAC
CCCAGCAGCAGCAGTACCCAGGGCAGCAAGGTTACCCAGGACAGCAGCAGGGCTACGGTC
CTTCACAGGGTGGTCCAGGTCCTCAGTATCCTAACTACCCACAGGGACAAGGTCAGCAGT
ATGGAGGATATAGACCAACACAGCCTGGACCACCACAGCCACCCCAGCAGAGGCCTTATG
GATATGACCAGGGACAGTATGGAAATTACCAGCAGTGAAAAAGTACTTACATTCCAGTAG
CCAGTATCTATTAGCAGCCATATTGTCACCTCAGCACTGTGGACACCTCCCTGTGAAGAG
ATCCTTCCATTCCATCTAGTTTTTGGAAAAACCTTGTGGATAAGTGGCTGTTTCATCAGT
AAGCAGCCTTTGTGGTTTAGTTATAAAAGGCTTTAGTAGCTCAAAAATACTCTTGATTTC
ACATTTCTACTCTAGATGGCAACATTGGACAGAAAATGCAATGACATAACCAATTTGTAA
TGATTTTGGAACTGTGTTTCAAATGGACTGTTACAGACTGAAAGGTGTGAACAGCTTTGT
ATGTTTATGAAGGGTAAGGGAATTTAATACTTTTCCACAGATTTTTTTGTAAGGGGAAGA
GGGAAATGTACACTTTTTACAGCAGCAATATTTTGTATATTATGTTTATTTCATGTGGTG
AATATGCAAGGCGGTACACTACGCACTGGACAGCATCAGAAATCCTCTGTTAATGTGGAC
TGGAACATGGTAGATGCTTGATTGTTTTGGTCTCAAAATGGTGTGCTATAAAGATAAAGG
TGAGGGGAAGACAAAGCACACCATATGTCCACTGTTCTGTTCTCATAGAGGAAATTCAAA
TCCCTTTTATCTATTAGATAATCAAGGGCACTGTGATACAGTTTTGAGTAAAAAGACATT
TTTTAAAAGCCTTCCAGTTTTGTGGATTAAACCTTTTTATAAAGATCATTTATAATACTG
TTTTAAAATGTGAGGCAATAAGAATTACTTTGTGTTGGATCTGAGGAGGCTTTGGTAAAA
CAGTTTCATCTAAATGAAAGTGGTAATCCTCTTCTAAAATAGCAATAACTGAAAATGAAA
GTGTTAATTTTACCTTGTTTGAGTTATCAGGGAACTTAGTAAGTAATATCAAAGCATTTT
ATAAATGATATCAAAGAAGAGTCAACATTGATCCAGTCATTTTATTTTGTAATATTGAGG
GATAATTGGTTATTAAACTGAATAGTTCAGGAGACTTTACAAACCTTTGTTTCAACTTTC
TTATCTGGAAATAATATCATTTATAAAGGGACACTTTTATGTTTTTCCCTTTTTTATGTT
GGTTGATATAACACAAAGAGATATTTAGGAAAATGCTTATTGATGAGGTTTATTCTATCT
GTTTTTAAAGCACCGAGGTTGCATTCTAGATAACCTTGTTTATTAGCATGGCATATTTTA
ATCATTATTTGAGACTGTCCTGTGCCTGATTATTTTAGCTAAATTCAGGGAGATTGCGTG
GGGCAGGAAAGCATGCATTGAAAAATTTCTAACCACGGTTATTTAAGCATAATCTGAAAA
CATCTAGCCCAAAGGTAAGTTGCTATTTTCATCACAGTTGCCTATGCCCAGGGAATAAGA
TGTATTCTTTATAATTGAATTGGTTTTTCCCACGTCTAACTGGAAACAAAACAGAAGGGG
CGTCATAAATTTGAATAAGCAGAACATACTGTTCTCAACATACTGTAATCAAAAGGAGGA
ATTTCAGTGGGTCTCTGTGTGTGTATGAGAGAGAGAGTGTGTGTTTGTGTGTTTCAAGGT
CAGAACAGGTTTTTTTGTTTTTGTTTTTTGTTCTTTGTTTTTTTTTTTGAGATGGAGTCT
TGCTCTTGTCGCCCAGGCTGGAGTGCAGTGGCGCAATCTCAGCTCACTGCAACCTCCGCC
TCCCAGGTTCAAGCAGTTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATGACAGGCACCC
GCCACCACACCCAGCTAATTTTTGTACTTTTAGTAGAGACGAGGTTTCGCCATGTTGGCC
AGGCTGGTCTCGAACTCCTGACCTCAGGTGATCCACCCGCCTCGGCCTTCCAAAGTGCTG
GGATTACAGGCGTGAGCCACCGTGCCTGGCCAGAATAGGTTTTTTCTTTCAACTTGATCA
GTAGAAAATGGACATCAAGTTTGAACAGATAAATCATGGACAGCCTTATTGTGATTGAAA
TGCTTGTAGGTTCTGTGCCAATTTTCCACCACTGTGTACTTTGTTGCTATTTAAAACTGT
ATCAACTCTAACGGAAGAATAAATTATTTGTGATTTTAA

Protein Sequence

>6760 : length: 418
MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVY
LATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQ
NQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMT
MSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQ
GNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGY
QQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPG
QQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQGQYGNYQQ