ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6756

Name

SSX1

Synonym

CT5.1|SSRC;synovial sarcoma, X breakpoint 1;SSX1;synovial sarcoma, X breakpoint 1

Definition

cancer/testis antigen 5.1|cancer/testis antigen family 5, member 1|protein SSX1|sarcoma, synovial, X-chromosome-related 1

Position

Xp11.23

Gene Type

protein-coding

External Links

Links to cell senescence gene database

6756

Links to epithelial mesenchymal transition gene database

6756

Links to ovarian cancer gene database

6756

Links to endometrial cancer gene database

6756

Links to iHOP

6756

Sequence Information

Nucleotide Sequence

>6756 : length: 1402
TCCTGGAGCAATGACATTGCAGAATATTTTCTCCTCCTCCAGCCACACTTTGTCACCAAC
TGCTGCCAACTCGCCACCACTGCTGCCGACCTCGCAACCACTGCTTTGTCTCTGAATAGA
GACAGGGTTTCCTTATGTTGGCCGAACTGGGCTTGACCTCCTCGGCTCAAGTGATCCTCC
CACCTCGGCCTCGGAACTACAGGTGAGACTGCTCCTGGTGCCATGAACGGAGACGACACC
TTTGCAAAGAGACCCAGGGATGATGCTAAAGCATCAGAGAAGAGAAGCAAGGCCTTTGAT
GATATTGCCACATACTTCTCTAAGAAAGAGTGGAAAAAGATGAAATACTCGGAGAAAATC
AGCTATGTGTATATGAAGAGAAACTATAAGGCCATGACTAAACTAGGTTTCAAAGTCACC
CTCCCACCTTTCATGTGTAATAAACAGGCCACAGACTTCCAGGGGAATGATTTTGATAAT
GACCATAACCGCAGGATTCAGGTTGAACATCCTCAGATGACTTTCGGCAGGCTCCACAGA
ATCATCCCGAAGATCATGCCCAAGAAGCCAGCAGAGGACGAAAATGATTCGAAGGGAGTG
TCAGAAGCATCTGGCCCACAAAACGATGGGAAACAACTGCACCCCCCAGGAAAAGCAAAT
ATTTCTGAGAAGATTAATAAGAGATCTGGACCCAAAAGGGGGAAACATGCCTGGACCCAC
AGACTGCGTGAGAGAAAGCAGCTGGTGATTTATGAAGAGATCAGTGACCCTGAGGAAGAT
GACGAGTAACTCCCCTGGGGGATACGACACATGCCCTTGATGAGAAGCAGAACGTGGTGA
CCTTTCACGAACATGGGCATGGCTGCGGCTCCCTCGTCATCAGGTGCATAGCAAGTGAAA
GCAAGTGTTCACAACGGTGAAACTTGAGCGTCATTTTTCTTAGTGTGCCAAGAGTTCGAT
GTTAGTGTTTCCATTGTATTTTCTTACAGTGTGCCATTCTGTTAGATACTATCCTTATAA
TTGATGAGCAAGACATACTGAATGCATATTTCGGTTTGTGTATCCATGCACCTACGTCAG
AAAACAAGTATTGTCAGGTATTCTCTCCATAGAACAGCACTATCCTCATCTCTCCCCAGA
TGTGACTACTGAGGGCAGTTCTGAGTGTTTAATTTCAGACTTTTTCCTCTGCATTTACAC
ACACACACACACACACACGCACACACACACACCAAGTACCAGTATAAGCATCTCCCATCT
GCTTTTCCCATTGCCATGCGTCCTGGTCAAGCCCCCCTCACTCTGTTTCCTGTTCAGCAT
GTACTCCCCTCATCCGATTCCCCTGTATCAGTCACTGACAGTTAATAAACCTTTGCAAAC
GTTCAAAAAAAAAAAAAAAAAA

Protein Sequence

>6756 : length: 188
MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKMKYSEKISYVYMKRNYKAMTK
LGFKVTLPPFMCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDE
NDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEI
SDPEEDDE